SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00036433001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00036433001
Domain Number 1 Region: 42-304
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.02e-55
Family DmpA-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00036433001
Sequence length 343
Comment pep supercontig:AMS_PRJEB1171_v1:HG380945:193013:194209:1 gene:GSADVG00036433001 transcript:GSADVT00036433001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIDIILILIFYLRTFPCEAPCEEKHSTKLKQTLIEDDSYNGSITDIDGILVGHSSKAE
RLTGCTVIICNTTCTAGVDVRGAAPGTRETDLLDPINAISNVNAIVLSGGSVFGLDSASG
VVQCLVEKKMGHPARDRLVPIVPAAVLYDLSVADNGPVAEGNVGAGSGASIGKILSINNA
MKAGLVTVGALVAVNAAGDIYKNGKLIAGAQTPDGKHLLNTVQYLLITDATLTKAQAKKI
SQMAHDGFARAINPVHTMLDGDVIFTLATGASPVSNINLIGMMAAETVERAIIRAVEKAT
GVSRFPSIHELNSNSTGQKTCVSCYYIILSFFLYLNSCQEAKY
Download sequence
Identical sequences GSADVT00036433001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]