SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00037516001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00037516001
Domain Number 1 Region: 6-173
Classification Level Classification E-value
Superfamily EF-hand 8.54e-31
Family Calmodulin-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00037516001
Sequence length 184
Comment pep supercontig:AMS_PRJEB1171_v1:HG380955:224611:225681:1 gene:GSADVG00037516001 transcript:GSADVT00037516001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQEDLQNICQQTGFTGKQVQRLYSRFKALDKNDCGYLTREDLQCIPEVNINPLGERLI
DVIMDDYGESNKINFKQFIFLLAKFRQGKMKSLVTEYNTRESKLRFLFDMYDRNHDMKID
RTELLDVLKMMVGGNILDDQIATIADHTIGELDKDGDRSITFEEFCKTLERIDADDKMSM
KFLN
Download sequence
Identical sequences GSADVT00037516001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]