SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00037838001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00037838001
Domain Number 1 Region: 2-68
Classification Level Classification E-value
Superfamily Plus3-like 4.71e-21
Family Plus3 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00037838001
Sequence length 74
Comment pep supercontig:AMS_PRJEB1171_v1:HG400758:61:393:-1 gene:GSADVG00037838001 transcript:GSADVT00037838001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNGSPVYRICEIRDVVETGKIYNLGATRTNKGLRLKHGHNERVFRLEFVSNSEISDSEFK
RWRETTIKQVRITF
Download sequence
Identical sequences GSADVT00037838001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]