SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00038691001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00038691001
Domain Number 1 Region: 36-181
Classification Level Classification E-value
Superfamily EF-hand 1.4e-27
Family Calmodulin-like 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00038691001
Sequence length 187
Comment pep supercontig:AMS_PRJEB1171_v1:HG383524:1142:1872:-1 gene:GSADVG00038691001 transcript:GSADVT00038691001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATINEETTDVGVVPEPALRTTLRDPIRESEERANQARLKRLTEAFTIFDQEANNTIPST
ELGTVVRSLGLVPTEGELQDILSEMSDDSNPESIHLDRFLSVMNIILKDRRYQGEPESKI
LRAFQVLDPDNNGFIREEDLQNYLCKEGEPFNDEEFQDFMTIALDDESDRICTYKDFIQN
LVVEDND
Download sequence
Identical sequences GSADVT00036761001 GSADVT00038691001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]