SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00039426001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00039426001
Domain Number 1 Region: 151-222
Classification Level Classification E-value
Superfamily SPOC domain-like 0.0000000000000231
Family SPOC domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1-58
Classification Level Classification E-value
Superfamily SPOC domain-like 0.0000137
Family SPOC domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00039426001
Sequence length 247
Comment pep supercontig:AMS_PRJEB1171_v1:HG380964:40149:41238:-1 gene:GSADVG00039426001 transcript:GSADVT00039426001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHFLAGSPTLASLLLGQPGDLVAAKTELRITQRLRLEQHRSDDLEKKLRANVIAALSTVG
NDSNSNLPNHLSNDLTTISSRKQQILPNQTKFSILIATPKIYNPNEITKSDQEGTTNGHI
KNESASPPPPPPSDTNDEHIKIKEETIDKTAADEDEAILSRLISYLVEKEAAGVISIPFY
PTYHQDYNHTSRQETAVLHIFPPCQFSKKVLKLICPSITFIDESHSSLHSNGKVLDEHLM
VVIIHSE
Download sequence
Identical sequences GSADVT00039426001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]