SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00040370001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00040370001
Domain Number 1 Region: 138-260
Classification Level Classification E-value
Superfamily EF-hand 1.4e-24
Family Osteonectin 0.0031
Further Details:      
 
Domain Number 2 Region: 73-133
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000604
Family Ovomucoid domain III-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00040370001
Sequence length 269
Comment pep supercontig:AMS_PRJEB1171_v1:HG380974:249211:250961:1 gene:GSADVG00040370001 transcript:GSADVT00040370001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKSFLLFLITILSCQQLFFIRAESEIKVEVQNGAVQTDDAKILNDFQDRCASTKCRDG
ETCILNKDGDAECACISQCEDPKDERLMVCTKANHTYTSDCEFFQMQCWCRKKDERCSRQ
EALTDSIDYFGRCQNIGICTDFELEVFPKRMNIWLGEILDALFIRKDLDAKYAVLVDEAR
KMKLSNTEKWWRNAVLWEFCELDQTHDNAVNSEEIARFVRSLKVLEHCIQPFLDHCDINN
DNKISSDEWGTCLGLDKDDMAFLKTFCSH
Download sequence
Identical sequences GSADVT00040370001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]