SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00041451001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00041451001
Domain Number 1 Region: 257-536
Classification Level Classification E-value
Superfamily SPOC domain-like 5.89e-59
Family Ku80 subunit middle domain 0.0000336
Further Details:      
 
Domain Number 2 Region: 4-192
Classification Level Classification E-value
Superfamily vWA-like 7.91e-32
Family Ku80 subunit N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 607-733
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 1.57e-28
Family C-terminal domain of Ku80 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00041451001
Sequence length 761
Comment pep supercontig:AMS_PRJEB1171_v1:HG380986:111795:115280:-1 gene:GSADVG00041451001 transcript:GSADVT00041451001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHNKEALALVVDIGAGMCDAIPGYDSPLQMASDILQMIVQRKMFQESKDELALILYGAD
ESNNDLADEDNYRNINVVFPLSPANWHLFEEIQKIKPGNNPADLVDAVVVAADHLRRETE
GKHGFAAKRVMLFTNAATTFSDHSLKTILDSLRRQDIIVDAIGPTWGQADEDDNQENNYS
DSPIELNGHDNDEEQSDAARPTTNGHQNHQTQKKPLTQQQQTGIRVIGEIVNNTEGTLFT
FREALTILSVHQSKIVKPTATKYIMQLADLKLHICTYIQVKDNKPGIFRFKKVYARDPTT
EIKVDRGRYTKDEQDQEIEKEELTDGFRYGTTFVPINKETLDEMKYQSEKCFSIIAFSDA
NMMKRSLYLGDTVYEVIAEAGFEEEAQAFAGLVQAMYDTNTVAIVRKCFSERSAPELGYL
RPHIAHDHICMYYIKLPFAEDLREFEFDNLDAIKKNQPSDEQLKCIDNLITAMDLTHADR
GGEEALRPEYVFNPYIQRMFQSIARRAVTPDEPLSLSNTIMEMNDTLLRSLASKSKRTLD
AIHEKFVLRDTDRRQKITTGDALFGNIDVSSKKPRLDENENIEEPTTDSEIINADSASFE
AQAAAKKKAAIRNVGTLTPVEDFKFLIEQGSPSLNEVCKQMANLILELVNNSHGDALFEK
AFQCLQCLRETCMNKLEPKLFNDLEFLIKKQASTIDGRKDFWKKLVDEKFSLITNEECVE
SNVIPIEAIKFLEEETPAEILNNAGTTNEQDGEDEDLFDLI
Download sequence
Identical sequences GSADVT00041451001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]