SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00050980001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00050980001
Domain Number 1 Region: 35-182
Classification Level Classification E-value
Superfamily EF-hand 1.36e-49
Family Calmodulin-like 0.0000777
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00050980001
Sequence length 185
Comment pep supercontig:AMS_PRJEB1171_v1:HG381115:34082:35339:-1 gene:GSADVG00050980001 transcript:GSADVT00050980001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIPLTSKKESDLTSCRLSHLILHPATYSYRLYSTTMSTFSAAKTEEFRHVFELFDKNGD
GSIDANEIGQVMRSLGLNPTNKEIADLIAEVDKNGNQRLDFQEFVTFMSKHWHERDQEQE
LREAFRLFDRDNSGFITINELKQVMLNMGEKLNQEELEDMMREADVNRDGKLDYQEFVQK
LLSTS
Download sequence
Identical sequences GSADVT00050980001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]