SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00051099001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00051099001
Domain Number 1 Region: 3-187
Classification Level Classification E-value
Superfamily EF-hand 7.09e-50
Family Calmodulin-like 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00051099001
Sequence length 208
Comment pep supercontig:AMS_PRJEB1171_v1:HG381117:5459:6313:-1 gene:GSADVG00051099001 transcript:GSADVT00051099001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNKPAGKLRQADLDYYRNLTTFTDAEIQDWYKCFHKDCPSGQLTSDEFKKIYAQVFPTG
DSSAFADHAFRRFDADRNQRISFREFLTALSITSKGNLEEKLNWAFGLYDTNGDGFITKN
EMLEIVTAIYRMVGTIMQMPEDESTPEKRTDKIFNTFDTDHDGRLTREEFIQGAKSDPSI
ARLLQCDTTAVAMSASENASSSTTCLRT
Download sequence
Identical sequences GSADVT00046269001 GSADVT00051099001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]