SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00055177001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00055177001
Domain Number 1 Region: 768-871
Classification Level Classification E-value
Superfamily R3H domain 0.000000000000373
Family R3H domain 0.0079
Further Details:      
 
Domain Number 2 Region: 151-207
Classification Level Classification E-value
Superfamily RING/U-box 0.00000194
Family RING finger domain, C3HC4 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00055177001
Sequence length 880
Comment pep supercontig:AMS_PRJEB1171_v1:HG381189:60078:63565:1 gene:GSADVG00055177001 transcript:GSADVT00055177001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESFASSDYSENLQLETTYSNNNNDNNHNQRKQKRRPMQTSSQDARYSHRSYQQQQQQQ
QQWYPENMYYDQYYYNPPPSRGGYMNHNYYNYQSQQPQQQHHHRRGQNRHPTSSGQMNQQ
ANIRPSNHHSLGRSTGEVENLRSTLTEQLLENVYECMICIIKINRDEEIWSCDICYKMFH
LNCIRKWANSEESGTDKNWRCPGCQYSYSTNPNYTCFCHKRTNPIFQPGEIPHSCGERCE
KRLNTKSNDCNHRCSELCHPGPCPTCTTMVKRSCLCGRESQTIMCSSNSLIKCENKCGKL
KLCQHHRCELVCHPRDCEPCDQLIKQICLSHGTEREVLCTTETGDTNLYTCGEVCGKLLQ
CGQHRCTKTCHDGSCSDCLLLPKNCKTCACGKTTMDNEQRTSCLDHLPTCDKLCDKILSC
GPTNDHHRCSAQCHNGSCPPCNKKSILQCRCGQSSQSTSCVEAIQYDPIKNPFCCERRCN
RKKICGKHRCTEMCCDRDIHVCEIICGKTLNCGIHKCEELCHKNPCRKCPINSYDELTCR
CGQTVLQPPIECGTKPPICNYKCDRTHTCDHPVYHSCHNDDECPPCTHLVSKMCVGEHTL
RNNVPCHLKEVLCGQPCGKPLQCGVHTCQRACHSGPCQTVDQKCTQRCAMKRRECGHPCN
VQCHGHEPCPSTTCREVVKVRCPCGRLLKDVVCNIKSNESSENKDDVNLTQSLVQALSVR
TIDLSLARKQQQQVQLPQLECDDECRIIQRNKALAQALSINPEESRQSVVVYTDFLRDYA
KRNIEFVQTVERQFAQLVEETQRHRASKRCHSFKPMKTNERHVVHELGTFYGLETQAMDP
EPHRNVTAYASYGVCKIPTALLSETIRREKLKVPPPVTLI
Download sequence
Identical sequences GSADVT00055177001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]