SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00057036001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00057036001
Domain Number 1 Region: 271-549
Classification Level Classification E-value
Superfamily SPOC domain-like 1.61e-59
Family Ku80 subunit middle domain 0.0000256
Further Details:      
 
Domain Number 2 Region: 587-738
Classification Level Classification E-value
Superfamily C-terminal domain of Ku80 1.7e-31
Family C-terminal domain of Ku80 0.00028
Further Details:      
 
Domain Number 3 Region: 4-166
Classification Level Classification E-value
Superfamily vWA-like 2.47e-30
Family Ku80 subunit N-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00057036001
Sequence length 766
Comment pep supercontig:AMS_PRJEB1171_v1:HG381230:109080:112197:-1 gene:GSADVG00057036001 transcript:GSADVT00057036001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNKEALALVVDIGVGMSQAAPGFDTPLQITSDILQMIVQRKMFQQSKDELALVLYGAN
ETNNELADDDNYQNVSVAFSLAPANWHLFEEIQKIRPGNNPADLVDAIVVAADHLRRETE
GKRGYAAKRVLLFTNAATPFSDHNLKIILESLRRQDIIVDAIGPTWGQQQEEEEQQQQQQ
QENATPENSSDHPDSPMHTNEHAKEESASARPTTNGHDHHQQHRSPKKPLTQQQQTGIRV
ISDIVNTTDGTLFTFREALGILSVHQSKVVKPTATKYVMQLADLKLHICTYIQVKDNKPG
IFRLKKVYARDPTTEIKVDRSRYTKDEQDEEIEKEELTDGFRYGTTFVPITKETLEDMKY
QSEKCFSIIGFSDAKTMQRSLYLGDTVYEVIAEPAYEEEAQVFTGLVQAMYETNSVAIVR
KCFSERSSPELGFLRPHIAHDHICMYYVKLPFAEDVRGFDFDNLDAIKRNQPSEEQLKTI
DNLITTMDLTHADRGGEEAFQPELMSNPYIQRMFQSIARRAVTPEDPLSLSNTIMEMNET
LIRSVATKSKRTLDELHDQFVLQDTNRRQKITTGDALFGNNDISAKKVRYEENGEEATTD
STSFEAQAAAKKKAALKTVGTVTPVEDFKILIEQGSPSFTDVCKQMCTLIIDLINNSHGD
SLFEKALQCVQCLREACINKLEPKLFNDFEVVLKKQAADIDGRKDFWKKLVEEKISLITS
EECIESNVIPIEAKKFLEEETANEAMNNLSIVGDQDDNEEDLFDLI
Download sequence
Identical sequences GSADVT00057036001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]