SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00058121001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00058121001
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily EF-hand 3.13e-25
Family Calmodulin-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00058121001
Sequence length 111
Comment pep supercontig:AMS_PRJEB1171_v1:HG386083:73:615:1 gene:GSADVG00058121001 transcript:GSADVT00058121001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DCIEAVDGDGSGTVDFDEFLALMAKKTKEAEDERELREVFRVFDKNSRGVIDVADLKMIF
KALDPDMPDDEVEQIISEVDEDGSGTVDYEGNKKQFTYCFNFLLFFSFSFK
Download sequence
Identical sequences GSADVT00058121001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]