SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00059192001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00059192001
Domain Number 1 Region: 1-103
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000422
Family p25-alpha 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSADVT00059192001
Sequence length 139
Comment pep supercontig:AMS_PRJEB1171_v1:HG381283:63679:64207:1 gene:GSADVG00059192001 transcript:GSADVT00059192001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDAHVIDTKYTTQLFDNDISRVLGKLTSGGTYQKGIKTFELNGFKQLIDQIAESKKTSA
DQIISQINSTGGPSLAGVTTTANKDITGRMTDTSQYTGAHKERFDSDGHGKGKEGRSDEA
KNTGYVGNYKNEGTYDKKH
Download sequence
Identical sequences GSADVT00059192001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]