SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00063221001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00063221001
Domain Number 1 Region: 82-151
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 2.48e-28
Family Cyanase C-terminal domain 0.00028
Further Details:      
 
Domain Number 2 Region: 1-76
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000000000506
Family Cyanase N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00063221001
Sequence length 151
Comment pep supercontig:AMS_PRJEB1171_v1:HG381416:65502:65957:1 gene:GSADVG00063221001 transcript:GSADVT00063221001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNISKLTQQLLKVKRDKCLSFADIGKKIGRDEVWAAALLYGQASMTDDECKKLDHTLGIN
LTPQEVHELTHPPSKGTLIKAFPPTDPLLYRFHEILAVYGIPMKEVIHEKFGDGIMSAVD
FTIKIDKDDTNKDAPRVNVTMSGKFLPYKKW
Download sequence
Identical sequences GSADVT00063221001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]