SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSADVT00064165001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00064165001
Domain Number 1 Region: 5-52
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000879
Family G proteins 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00064165001
Sequence length 53
Comment pep supercontig:AMS_PRJEB1171_v1:HG387907:117:342:1 gene:GSADVG00064165001 transcript:GSADVT00064165001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGRKKVLLKVIILGDSGVGKTSLMGQFVSHRFSNQYKATIGADFLTKEVQIE
Download sequence
Identical sequences GSADVT00064165001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]