SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00002130001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00002130001
Domain Number 1 Region: 520-657
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000141
Family Calmodulin-like 0.038
Further Details:      
 
Domain Number 2 Region: 354-400,439-563
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000471
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00002130001
Sequence length 774
Comment pep supercontig:AMS_PRJEB1171_v1:HG380763:675966:679055:1 gene:GSADVG00002130001 transcript:GSADVT00002130001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYIEQQHIRSPPPLNYLDATSSSSENDSYVDGRFPNKKNQGQYNSQRHGNNPCKQLFRFI
RKLWATQQTENINCEENLNVYAKTTIRELTIYLVFVSVLSIVVFGMVSSNMFTLTQALKG
VFVDAHMTDDANKTGASFSELNHMEDFWQYMNDIAAPGFFTENWYNDDNVSNYGYILYEN
RLIGSIQMRQKKVRNNSCIVADDFKHEIKFCLNSYAPAFEEKNSFGPCENFDAENCTTEA
FKYTPSTSLFGFTTTGRVGEYDQGGYVHTFASSQEEFKNEIAELKENLWITLGTRAIIVD
FTVYNANLNLFCQVQLMFEFPAVGGVVTSSKFRAVKLIRYVDVFDYFVLSCEILVALFIV
YYSIEEILEIKTMKSRYFHSVMNCLDLIVIILSYICMGFNIYRQIQVNNLLDQLLQKQTR
QYSDFTFLCYWQYQLNNVISATIFLAWIKIFKYISFNKTMTQLSETLTKCAKDISGFALM
FFIIFSAFAQLGYLTFGIQIEGFRAFQYSVYTLFLVILGSFDFPALQQAHRVLGPIFFLT
YVFFVFFVLLNMFLAIINDTYMEVKADLKNRKSQFALGDFVKQGYAKMRQRLTIKRDRLA
DIRKALSVADVNCDKVLDFEEWRTEMKSRGYAEEEIEQMFARYDTNGDRVLDEDEQRVLK
EDLARQSDAILREMDQLNMTTNNISMRRSNSERKSSTSSSQDSKIQDATMDDYTDLDRRI
DTMESSVNLLSSKIDTVFSKLDAYEKPQSNHSATTVGFEHLPRSIINIEHNPIH
Download sequence
Identical sequences GSADVT00002130001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]