SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00004285001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00004285001
Domain Number 1 Region: 28-151,261-340
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.88e-36
Family Calcium ATPase, transmembrane domain M 0.005
Further Details:      
 
Domain Number 2 Region: 151-257
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 9.02e-25
Family Calcium ATPase, transduction domain A 0.0007
Further Details:      
 
Domain Number 3 Region: 336-371
Classification Level Classification E-value
Superfamily HAD-like 0.0000412
Family Meta-cation ATPase, catalytic domain P 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00004285001
Sequence length 444
Comment pep supercontig:AMS_PRJEB1171_v1:HG380770:243775:245351:-1 gene:GSADVG00004285001 transcript:GSADVT00004285001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNNPSIQLDDMSKQRPVIIDVCLNQPHKISLNELCLQLNLFDTRSGLTTDQVNEALTK
YGPNQTTPATQPGYIRLFFIQAFTGFNALLWIAAIFAFLAYEPFGRPNPDSTNLGLGVVL
TIVIIANAVLNVYQKMKSVKIIRSFTQILPKLTTVRRNKGCEQQIPTVNLVPGDIILLQI
GDKVPADCRIISCNNLKVNNAELTGESKPVKCTIDATNDNLLEATNMAFYSALVVEGKGE
AIVVATGDQTILGRVSKLTRSSNTDEITGLHREVNRFILFVLCFYPNYISFNANVINSVG
MIVGFLPVGLPSAVTLVLVIVAKYMSAQQVLVKSLQTVETFNSISIICTDKTGTLTQNKM
TCTHLLWDINDEYQVPSTTIVSQDKREWKSIFGTLMRHLSTASGSRSATPADSLNASDSF
QTKRLGLDEINIQATPHRELILGN
Download sequence
Identical sequences GSADVT00004285001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]