SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00009455001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00009455001
Domain Number 1 Region: 526-664
Classification Level Classification E-value
Superfamily EF-hand 0.000000000114
Family Calmodulin-like 0.021
Further Details:      
 
Domain Number 2 Region: 351-405,443-567
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000314
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00009455001
Sequence length 839
Comment pep supercontig:AMS_PRJEB1171_v1:HG380790:528153:531522:-1 gene:GSADVG00009455001 transcript:GSADVT00009455001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSKTPTSYANPAFDEEPAGVRNSGGPSPMGSNIFIVKPDDAKKSRSHPEPNRHDPVTKK
NFGWTILRGIRSLWATRQTEKDLRKNKDLYVKTTIRELILYLVFITILCIITFGMTSTKT
YYFTTVLRTIFTERKASGIGDRPTYDDIANFDDFWDITSGPILNGLYDQTWYNGENLTAD
QYGYVLFENKILGLPRLRQLRVTNHSCVVHKKFQSTIPDCYGPYSGSNEDRRTYGPTNDT
VTPTAWQYQTSSQLRGSSSSGLISRYGGGGFVQDLTTNYNDASNEVADLNANLWIDRGTR
VVFLDFTVYNANINLFCQIKLTVEFPASGGAVPSKSFSTVKLIRYVSSMDYFVLACEILF
IIFTVYYTVEEILEIKHYRFHYFKGIWNVLDIIIILISYICVAFNLYRQQKVGQILDELL
KNQNSFADFEFLTYWQIQFNNVVAFAVFLAWIKIFKYVSFNKTMTQLSTTLSRCAKDVLG
FSVMFMIVFLAYAQLGYLLFGTMVDDYKTFAISIFTLFRIILGDFDFNAILEAHRILGPI
FFLTYVFFVFFVLLNMFLAIINDTYSEVKSDMTTQKSEFELGDYFKRSYDKMLERLNVKR
DRIIEIQNALKSADVNKDGVIEFDEWRRDLKARGYTDVEIENVFSRYDTDGDRVLRDAEQ
RRFHADLAAQENNLDMDIQDLNESQVAQKVNPVTGAGVSATGGNGGNEGDNINRITYDEF
AILVRRIDRMEYSIGNIVSRIDGVLTKLETLEKGKMKRREALTKILNSIAEDNEMSKEMK
QERLEKMIRDELEESNSDRQTPVQSLLASTPGAPGSGHTSQQDKSSRRHSPTSAGGSKY
Download sequence
Identical sequences GSADVT00009455001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]