SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00018112001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00018112001
Domain Number 1 Region: 952-1050
Classification Level Classification E-value
Superfamily PDZ domain-like 3.86e-24
Family PDZ domain 0.00093
Further Details:      
 
Domain Number 2 Region: 227-321
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.4e-19
Family Ras-binding domain, RBD 0.00018
Further Details:      
 
Domain Number 3 Region: 40-131
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.38e-16
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 4 Region: 369-463
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.00000000000000704
Family FHA domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00018112001
Sequence length 1721
Comment pep supercontig:AMS_PRJEB1171_v1:HG380836:64405:72870:1 gene:GSADVG00018112001 transcript:GSADVT00018112001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMNGLPKDRSEILNLINEWNSTRLDLFKISEPNEVLDFYGVMRFYFQDAEDKVTTKCIR
VASTANTLDVIRVLMEKLRPDMKTLPNEKDYCIYEVHPNGDGRKLEMDERPLWVQLYWGK
DQREGRFVLQNAKLPKLTKPIGGSFKERRSSKRESKKKKKQDKKNGIDENDNQSSIVTPT
AIGESLYKSVPETNKFTRSLSNPEMVKKIQQDRLKQKFIKISTKEGGGTMKVFGDALNPS
IPYKTFLLSIKDTAEWVVKEMLEKYGLKHEDPQNYCLLQIVIPPRDQMDNKIIKEVILHD
KECPLSICLNHAQKNEGSIMFKVVKCPPEYIEIRKRLRAQESAMDSVPTPSIQDRTINDH
LSMFVEVKNDGTDLATPRVFKIHPNTTYVGRDAKAGVGKQYFYIDGVGIDRDHCTIHNQN
GIVTLTPRGEVWLNGKLVSTPFVLQHGSMVCFGRNSTFRYCDPQFVNKTTIKPKAQLNGD
KSVTHGSLSTLPMAGTKKLNQVESNTLQIRPPKDLQTKKSNQNVDPGTMIDVLPGLLEVP
TETENRFLHAVFENYPLNNIQFRLSPVYAIYMTLRHRLSPYGKPNFPLVQKQENIISLLY
RIEDMISKKIEECHEHGGYLAYWIANTSELLYFIKQDRDISKISHDVQDRLAECVQRLFR
YLTHLVQNELDKYLISFTNPQDDVEHDVYIAFDENSSTNVKLSDARWVTLDMNTDNYHQA
TLGDILATLSSIMDLLRKCRVNAALTIQMFSQIFHYINTWLFNRMVCCPELKLCSHFWGE
KLSVRLKSISDWAQRQGLELASDCHLTKVNQICLLLQNNKRDTHDVQQLISINNFKLNSI
QVKQILNNYVLNRNEAPISSTFSQALLAATYKHVDENLRREGVLVQLAEEPELNLPFLLP
EDGYTCENLRSIPQQLFEFIEPMSRSSLCRLFTNPHSLGMWTEFMQAPNMENGLSNSSDG
SHSVETVTLSKKGNSLGLSIVAAKGESQQFQGIYIKAIVPGGAAEDDGRLQAGDQILCVD
KISLIDITQEQAAEALKQCGPMVTLQVLKDAANRQGLSALLTKPSENHHHQQQQQQHHHP
LPPQMPPTIIGQPRPASRSQLPVTSSSYEFVYNAKSVPINNTNSQQQQPPSFHQQQRLVQ
NENPLRLIQPARSAQLLAEEENNHDLLHNYLSTQQHQSNPNLFHSNQNQYPPINNNRNQT
FEIPKRTYDHDNHHVNGNEHYHHHHHHQHHNGHGGGEEEEEEEEIEEDEDDLQPTNFIRS
ASERQSFGDRNLSTAPPLIFREDIPPTQNGYTNGNHHIKPINHTQSAIGPTIAPKPLPKP
MISALALIKHTNTTNDNDLTHRLSKASLSSSSDHLAPPVRKPRTPQPEAPKLANSRQNNI
SEFRLKRINDLSNRPERNDVEEKELSNLQLEHEFDRRVEEFNFHTNGNENEEERINIIPI
STISPSPNSTDDMNEFDEKLKRRLEQYEHDRQVERAHVNRLQAKREADLEARLRKDRDRT
DRDIRDLQMRRMSEEDRSIEAKKEQARLSKHIRIPDSPPLSNDSMKHSSSSGHIPISKDN
FENQFSPPIPPPPPTRDISFAVANNIKQSLMQRTANDHHLISPPLPPPPPLGHETSPTSS
IVAIPVSSLHAVERITAELTRRDDLYTHDDTSNHHTPSVIGAQEVYLDPRFRTKRFQQQN
GHMNGINKENVNNEDSSGVSTETMSFRDKLKFFRKPPDQEE
Download sequence
Identical sequences GSADVT00018112001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]