SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00022662001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00022662001
Domain Number 1 Region: 185-467,498-636
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-71
Family Tandem AAA-ATPase domain 0.02
Further Details:      
 
Domain Number 2 Region: 911-970
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000000602
Family AN1-like Zinc finger 0.0021
Further Details:      
 
Domain Number 3 Region: 706-767
Classification Level Classification E-value
Superfamily R3H domain 0.0000000000432
Family R3H domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSADVT00022662001
Sequence length 1015
Comment pep supercontig:AMS_PRJEB1171_v1:HG381778:1784:5492:-1 gene:GSADVG00022662001 transcript:GSADVT00022662001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGVEVFTEKCRDLLEIEREEEINQSTEALKGQPIKRLAERGLCLTRLHFQYTYTGLYGR
TILVFEGESLSRVQTFGPGDIAGIYQQGHSIDDQNPLARGLIFRLTTNTIHITIEDTDDE
QFNSLGDTCLFMIIKMANDVTYRRLKHGLTLMMKQRQGIAHHLLDIAFDNDDPIPSNFSQ
NTGPTQWFNENLDESQRDAVSFALASRDISIIHGPPGTGKTTTIVEYILQEALKRDAKIL
CCAPSNIAVDNLVERLGRKKQLKLIRLGHPARLLESIQCFSLESIVTENYQDVKNAIRED
LNLCFTKLRKSSIDRGERERLKNEIKHLRKDIRVYEEKASREAMKSVNVILCTLTSATDD
SPLKLLPPNHFDLVVIDECSQTLEVACWLALLRAPKCVLAGDHLQLPPTILSEKAAKDGL
AITLMQRLIEKFDDKITRMLTIQYRMNEAIMKWSSEEFYHGKLVADKSVRSHLLKDLANI
SKRDNEYEVDDENLSQCPLFLIDTTGYDMPEICFDDENSRGNEGEVALVNTHVKELVENY
GVSVDQIGVITPYNMQVQLLRRKLLNTYPTLEIKSVDGFQGREKEVIIISMVRSNLRGEV
GFLSDSRRINVAITRARRHLCVICNVQTVSHDPFMKRLIDYMLENGEVRSAFELVDDNNF
FQGAISSRKSTTSSKQTKQQTKKPKQQPKPRSEATNILENVLTNILDQRIDAFLKDHNAQ
RLQFEDDLSPFGRRYVHELAEKRNLQHISEGMDDQRHITIMKKSSNENATQPKIVKKVEK
EEEMTTQFRSFSVLEKEEKHSKLNKDKNITTTTTTKPQEETLHEDISSSEKTASPVLDLT
NLCRFCHKDIPPQNLQLHEIYCQRMNPLPSVSTTTNETSNIASSKLNVAAEHPKTVKKKS
NKLESLNSETSFDDLLEAARQQDNVCNAQRCKIKITLLGQLCSYCNRRYCFEHSMPEVHG
CGHQARTDIRQTHIATHSNVRPVYENSTINKDKRPYLERKLQDKINSKESQRKKK
Download sequence
Identical sequences GSADVT00022662001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]