SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSADVT00048117001 from Adineta vaga

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSADVT00048117001
Domain Number 1 Region: 530-661
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000637
Family Calmodulin-like 0.025
Further Details:      
 
Domain Number 2 Region: 356-410,448-572
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000369
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSADVT00048117001
Sequence length 827
Comment pep supercontig:AMS_PRJEB1171_v1:HG381066:90014:93479:1 gene:GSADVG00048117001 transcript:GSADVT00048117001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAKMNARTASLGDSVFDEKSNKRKNTGTVSPANSDIFVVKPGGDKRNLTHSEQQRRSPV
AKRGIGRTILHGIRSLWATRQTEKDIGKNKELYVKTTLRELIIYLVFIVILCIITFGMTS
SKTYYFTTVLRTIFTERKIIDIGDQPAFDDIANYDDFWNVMSDKVLNGLFDTKWYNGENI
TNDQLGYVLFENKIIGLPRLRQLRMKNNSCVVHKKFRSLIDECYAPYSSRKEDQGRFGPE
NRSLLLSEEPWNYKTSSELQGSSRSGLISRYSGGGYVQELTRNFETAQAQIANLKENLWL
DRSSRVVFLDFTLYNANINLFCQVKLTVEFPASGGAVSSKSFASVKLIRYVSTMDYFVLA
CEILFIIFTIYYTVEEGLEITRFKIHYFKTIWNVLDVLILLISYICIAFNIYRQVKVSEI
LDELLDNENTFADFEFLSYWQLQFNNVIAFTVFLAWIKIFKYVSFNKTMTQLSTTLSRCA
KDVLGFSVMFMIVFLAYAQLGYLLFGSMVEDYKTFSASIFTLFRIILGDFDFDAILNVHR
ILGPIFFLTYVFFVFFVLLNMFLAIINDTYSEVKNDMSTQKSEFELGEYFKKSYGKMLGR
LHLKRDRVIDIQNALKAADTNKDGVIDFDEWRRELKSRGFTDAEIENVFTRYDTDGDRTL
RNIEQTHFQKDLSTQENDLDKDIKNLNDESDNAVKLNANGQKEIDNLNHITFDEFKILIR
RMDRMEYSVGNIVSRIDDVLTKLEAMEKGKVKRREVLTRILNSMTEDNHLSKEVKHERLE
KMIREELIENSSDRQSPGAPSSVYRSNTSLRHEDEFSRIPSGMKFNQ
Download sequence
Identical sequences GSADVT00048117001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]