SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390956573|ref|YP_006420330.1| from Terriglobus roseus DSM 18391

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390956573|ref|YP_006420330.1|
Domain Number 1 Region: 113-302
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.28e-61
Family B3/B4 domain of PheRS, PheT 0.0000146
Further Details:      
 
Domain Number 2 Region: 392-611
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.34e-26
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00049
Further Details:      
 
Domain Number 3 Region: 620-713
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 0.000000000000011
Family Anticodon-binding domain of PheRS 0.0018
Further Details:      
 
Domain Number 4 Region: 321-399
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000000000659
Family Domains B1 and B5 of PheRS-beta, PheT 0.0022
Further Details:      
 
Domain Number 5 Region: 1-76
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000174
Family Domains B1 and B5 of PheRS-beta, PheT 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390956573|ref|YP_006420330.1|
Sequence length 721
Comment phenylalanyl-tRNA synthetase subunit beta [Terriglobus roseus DSM 18391]
Sequence
MNILSKWLREYLPALEVSDRQLAEDLTLRGIAVEGVHALPDGGHLFEMDITTNRVDAMNH
YGIAREAATLYGVPLLTLEDRRVVHAEMGDAAGAALPSIACEIFAPAGDSPGGYPVRIEA
EDLCGRFTAQIIRGVTVKPSEGIVATRFEQLGQKAISNAVDITNYTWLAMGQPTHVFDLD
KLEGSIVVRRAHAGERIKLLDGSEKTLTADDLVVADEKKALGLAGVMGGWDSRVTEETKN
ILVEAAWFDPAAIRASSRRHGLHTDASHRYERGADLGACALANRLVTRGVIAACGGEAVG
AMTEVVVEAQELRTTKRPHVLLSVDEVQRLLGTTLESGTSGNLVPPEVIEQYLQALGCHL
RPSDDAATFEVTLPSWRLDLEREIDLIEEIARVYGYNRFADTLPSFSGGVAALPHAAKED
KVREVLRSLGWTEAISSTFCSEADASTFAAPGTSGVPMGNPLNAEAGMLRPSLLPGTVGM
LQLNGTRDVRAGRIFEYGTVFIGTTAQVVEHPSLALGAFGEAIGTKTIDAADALFFEVKG
AVEDVLARFVLPAVSFTGDGLPAWIEGGRGAAIKVESKTIGWLGELTNTERERRKLKEVA
VVAEINIPALYEYALRQPSAQEPSRYQAVERDFSFLFADTVQWKDVDAAIRALGIAEMIS
LAPVEIFRDAKGKAVARGEYSLLLRTVFQSPERTLREEEITAWQDAIVASLLKLGGRHRA
A
Download sequence
Identical sequences I3ZCM7
WP_014784564.1.4782 gi|390956573|ref|YP_006420330.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]