SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|390957221|ref|YP_006420978.1| from Terriglobus roseus DSM 18391

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|390957221|ref|YP_006420978.1|
Domain Number 1 Region: 576-902
Classification Level Classification E-value
Superfamily Methionine synthase activation domain-like 9.68e-124
Family Methionine synthase SAM-binding domain 0.0000000159
Further Details:      
 
Domain Number 2 Region: 23-297
Classification Level Classification E-value
Superfamily Dihydropteroate synthetase-like 1.22e-89
Family Methyltetrahydrofolate-utiluzing methyltransferases 0.002
Further Details:      
 
Domain Number 3 Region: 421-570
Classification Level Classification E-value
Superfamily Cobalamin (vitamin B12)-binding domain 3.27e-45
Family Cobalamin (vitamin B12)-binding domain 0.000000885
Further Details:      
 
Domain Number 4 Region: 322-408
Classification Level Classification E-value
Superfamily Methionine synthase domain 1.83e-26
Family Methionine synthase domain 0.0000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|390957221|ref|YP_006420978.1|
Sequence length 903
Comment methionine synthase [Terriglobus roseus DSM 18391]
Sequence
MTGDSKPLRLSGSQPFTQQAGVFIMLGERTNVAGSPKFAKLIKEGKYEEAVSVARQQVEN
GANVIDICMDEGMIDGVAAMSRYLQLLASEPEVAKVPFMVDSSKWEVIEAGLKCLQGKGI
VNSISLKEGEDKFRQNARTVLKYGAAVVVMAFDEQGQAATYEDKIRICERAYRILVDEVG
FPAEDIIFDPNILTVATGMEEHNNYAVDFINATRWIKANLPHAKVSGGVSNISFSFRGNN
KVREAMHSAFLYHAIAAGMDMGIVNAGMLELYDAIEPELKVLVEDVLLNRRPDATERLVD
YGEQLKAAGTSNPEAAAKKAEEWRSGTVEERLSHALVKGIDAYIDEDTEEARAKLGRPLL
VIEGPLMEGMSVVGDLFGAGKMFLPQVVKSARVMKKAVAYLFPFMEAEKAEMAAAGIVMR
TQGKIVLATVKGDVHDIGKNIVGVVLACNNYEVFDMGVMVPAEKILARAKEVNADIIGLS
GLITPSLDEMVHVAKEMERQGFTIPLLIGGATTSRAHTAIKIAPHYGQPVVHVTDASRAV
PVTTNLLSEDNRAQYVAQHAAEYDAVRKAHLAPKQPMVPIATARLRRTPIEWRSEEIAQP
EFFGVRVLDHFPLTELREYIDWSPFFHTWGLKGIYPRILDDKLQGEEARELYVNANKMLD
RIVGENLLRARGVYGFFPASAIGDDVELYSDASRSEVREHFYFLRQQAHRDGNEPCRSLA
DFIAPKETGLPDTIGAFAVTSGLGLKELCDGFRAQHDDYSAIMAEAVADRLAEAFAEALH
KRVRDQWGFGCNEGLTTQQIIAEKYRGIRPAPGYPACPDHTEKGTIWRLLDAQANTGIEI
TESFAMWPGSSVSGIYFAHPESRFFSLGKIDRDQVQDYAKRKGMPLVEVERWLGPNLNYD
PEA
Download sequence
Identical sequences I3ZEH5
WP_014785212.1.4782 gi|390957221|ref|YP_006420978.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]