SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|434398837|ref|YP_007132841.1| from Stanieria cyanosphaera PCC 7437

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|434398837|ref|YP_007132841.1|
Domain Number - Region: 115-176
Classification Level Classification E-value
Superfamily Apolipoprotein 0.00301
Family Apolipoprotein 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|434398837|ref|YP_007132841.1|
Sequence length 180
Comment hypothetical protein Sta7437_2334 [Stanieria cyanosphaera PCC 7437]
Sequence
MKKLIEKVKSWNLNRIFIIFLAGSLLVLSTACGQGNVASTPSGVEKSLSKNYDTNQVSQN
RKDVFSDDERDVQFKAQTTQVPQGGMNLFNDDPRYDNPNVQAQSKSLVEQSKFRDEKYNN
VGDYVNNVTDSAAKNLEQTKEDLTQGAKERTRALQRNLETASENAKNAAENVKENLPDLT
Download sequence
Identical sequences K9XTE6
gi|434398837|ref|YP_007132841.1| WP_015193543.1.48393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]