SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|403525715|ref|YP_006660602.1| from Arthrobacter sp. Rue61a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403525715|ref|YP_006660602.1|
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily Recombination protein RecR 1.18e-74
Family Recombination protein RecR 0.000000958
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|403525715|ref|YP_006660602.1|
Sequence length 199
Comment recombination protein RecR [Arthrobacter sp. Rue61a]
Sequence
MYEGAVQELIDELGRLPGVGPKSAQRLAFHILEADPEDMKRLVTAITTVKERVKFCTVCF
NVTEQETCNICRDQRRDPSVICVVEESKDVLAVERTRSFRGRYHVLGGAINPIAGIGPEQ
LRIRELLTRLNDGAIQEIIIATDPNLEGEATATYLARMLKSIGITVTRLASGLPVGGDLE
YADEVTLGRAFEGRRNALL
Download sequence
Identical sequences A1R2K7 J7LSQ0
gi|403525715|ref|YP_006660602.1| gi|119961171|ref|YP_946469.1| 290340.AAur_0665 WP_011773417.1.67142 WP_011773417.1.74535 WP_011773417.1.83037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]