SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|403525869|ref|YP_006660756.1| from Arthrobacter sp. Rue61a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403525869|ref|YP_006660756.1|
Domain Number 1 Region: 8-176
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 5.1e-33
Family Phosphoglucomutase, first 3 domains 0.00028
Further Details:      
 
Domain Number 2 Region: 164-271
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.26e-28
Family Phosphoglucomutase, first 3 domains 0.0000964
Further Details:      
 
Domain Number 3 Region: 291-383
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 4.32e-25
Family Phosphoglucomutase, first 3 domains 0.001
Further Details:      
 
Domain Number 4 Region: 387-472
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 1.7e-19
Family Phosphoglucomutase, C-terminal domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|403525869|ref|YP_006660756.1|
Sequence length 472
Comment phosphomannomutase [Arthrobacter sp. Rue61a]
Sequence
MTIEQNKTFDLSASFKAYDVRGIVGESITAEIVEAVGAAFIDVLGLEGETVLVGGDMRPS
SPEFSRAFANGAATRGANVQLLDLISTDELYYACGALNAAGATFTASHNPAAYNGIKMAK
AGAQPISSESGLKEIQALAEQYLNTGTIPAAVTRGEIGVHDVLKDYSEYLRKLVDLSGSR
PLKIVVDAGNGMAGLTTPAVLGDKLLPALPFEIIPLYFELDGSFPNHPANPLEPENLRDL
QAAVIKHGADIGLAFDGDADRCFVIDEKGEPVSPSAITGMVARREIARAQAAGEETPVII
HNLLTSKAVPELVAKDGGRAVRTRVGHSFIKAVMAEEGAVFGGEHSAHFYFRDFWNADTG
MLAAMHVLAALGEQDGPLSELGRQYEPYVSSGEINSEIEDKAGAVERVRVDFETEDIDID
HMDGSTFTAKDGSWWFNLRPSNTEPFLRLNAEAKDQATMEKIRDRVLALVRA
Download sequence
Identical sequences A1R321 J7LMM5
gi|119962905|ref|YP_946633.1| WP_011773581.1.67142 WP_011773581.1.83037 gi|403525869|ref|YP_006660756.1| 290340.AAur_0836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]