SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|403528990|ref|YP_006663877.1| from Arthrobacter sp. Rue61a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|403528990|ref|YP_006663877.1|
Domain Number 1 Region: 104-298
Classification Level Classification E-value
Superfamily Formyltransferase 9.55e-64
Family Formyltransferase 0.0002
Further Details:      
 
Domain Number 2 Region: 20-100
Classification Level Classification E-value
Superfamily ACT-like 9.16e-17
Family SP0238-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|403528990|ref|YP_006663877.1|
Sequence length 299
Comment formyltetrahydrofolate deformylase PurU [Arthrobacter sp. Rue61a]
Sequence
MTAIQTETTAASTAETTVEHVLTLDCPEGPGIVHAVSGFLLDHGCDIIDNKQFGDRAEGH
FFMRVHFASDGDDSTVDQLRNAFAPVGEKYGMNWQLERQGYKRRVLIMVSKFGHCLNDLL
FRARIGELPIDVVGVVSNHTDHQGLAEWHGIPFFHIPVTAATKPAAEGRLLEIIDELDVE
LIVLARYMQVLSDDLARKLDGRAINIHHSFLPSFKGAKPYHQAYARGVKTVGATAHYVNG
ELDEGPIIAQQVVEVDHTFGPDDLVAAGRDTECKALSNAVRWHCEGRIILNGNRTIVLK
Download sequence
Identical sequences J7M066
gi|403528990|ref|YP_006663877.1| WP_014923054.1.83037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]