SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G00390.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G00390.1
Domain Number 1 Region: 169-370
Classification Level Classification E-value
Superfamily ARM repeat 8.45e-19
Family Armadillo repeat 0.048
Further Details:      
 
Domain Number 2 Region: 28-167
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.00000000271
Family Protein kinases, catalytic subunit 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G00390.1   Gene: BRADI1G00390   Transcript: BRADI1G00390.1
Sequence length 495
Comment pep:novel chromosome:Brachy1.0:1:324003:329816:1 gene:BRADI1G00390 transcript:BRADI1G00390.1
Sequence
MPGLAGSNHPRPARLPTRAVGYRSGRKVHGSVCLASVVVTQTLDWKLHAFDCLSEFDANN
EASGSPMLQLEWLVGTQYKPMELTKSGWASIRKSPPWAIDSWGLGCLIYELFSGAKLART
EDLQNTTSIPKSLLPAYQRLLNSTPSRRLNPSELIDNSEFFQNKLVETFQFMEALNLKDN
IEKDSFFRKLSDIAEQLPREIFLKKLLPVLASSPELDSAAATALSALLKLGSRLPADQFS
IKVLPTIVKLFASNDRAIRACLLQHIVQFGESLSDQTVDEQVYPHVATGFSDTTVSIRKL
TLKSMLVLEPKVDEDPGIRINTAILLGNIANHMNDGEHTLFSEDELERLLVDWINNPNTG
DPLTVVEVRYQVIRKKQIVDGLAVTIFIKKEGPKEKVLIKIRVSRREALGMLLDKDYNRI
LQVQESHLEPVKDFHNESLLRQKYDALLLEKEVSEAHMNHKYNTLLLEKDSLLWEKEQLG
IILILLSIFNFFHQF
Download sequence
Identical sequences I1GKF6
EG:BRADI1G00390.1 15368.BRADI1G00390.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]