SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G00607.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G00607.1
Domain Number 1 Region: 12-762
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-276
Family Motor proteins 0.0000000000217
Further Details:      
 
Domain Number 2 Region: 764-860
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000186
Family Motor proteins 0.053
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G00607.1
Domain Number - Region: 897-1005
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0144
Family Myosin rod fragments 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G00607.1   Gene: BRADI1G00607   Transcript: BRADI1G00607.1
Sequence length 1441
Comment pep:novel chromosome:Brachy1.0:1:485291:498694:1 gene:BRADI1G00607 transcript:BRADI1G00607.1
Sequence
MDGLVEEINGEELVVNCTSGKKATVNVSSAYPKDTESPRGGVEDMTRLAYLHEPGVLQNL
KSRYALNEIYTYTGNILIAVNPFQRLPHLYNNHMMGIYKGAEFGELSPHPFAITDRAYRL
MINDRISQAILVSGESGAGKTESTKSLMQYLAFMGGKAQAEGRSVQQQILESNPVLEAFG
NAKTVRNNNSSRFGKFVEIQFDQNGKISGAAIRTYLLERSRVCQISDPERNYHCFYMLCA
APPEEREKYKLGEARSFHYLNQSNCIELNGMDDSAEYVETRRAMGIVGITSDKQDAIFKV
VAAILHLGNVEFAEGSEADSSVPKDEKSQFHLKTAAELFMCDQKGLEESLCKRVMATRGE
SITRNLDPKAAALSRDALSRIVYSRLFDWLVTTINTSIGQDPESKILIGVLDIYGFESFK
TNSFEQFCINLTNEKLQQHFNQHVFKMEQEEYTKEEIDWSYIQFVDNQEILDLIEKKPGG
IIALLDETCMLRNSTHETFAEKLYQKFKDNPHFSKPKFSRSDFTVHHYAGNVTYQTDLFL
DKNIDYAVNEHQILLHASKCPFVSSLFPPSEESSKATKFSSIGSSFKQQLQSLLETLSAT
EPHYIRCIKPNNVLKPAIFENSNVLQQLRCGGVLEAIRISCLGYPTRRTFYEFVNRFGIL
QPKALSRSHDEITATKMLLEKTNLVGYQIGKTKVFLRAGQMAELDALRTEVLGLSAKKIQ
TKVRSFLSRKKYIRMRICATQLQAVCRGTIARSCYENLRREASSLKIQTFYRMRHERKKY
RDICSASTTIQSGLRGMAARNKLRFFRQTKAAVIIQSQCRCHLARSRYVRLMKATITTQC
AWRGKVARRELRQLKMAAKETGALQAAKSKLEKEVEELTWRLQLEKRIRSDMEEAKTQEN
KKLQLQLQELQLQFKDTKESLKREQEAAKAASEKAALVPEIRVDATQVTELTAENERLKT
LVSSLETKIKETEQRFEETEKVREQWLKKATDAESQINELKNTVQSLREKLTTAEADNSV
LRQQAMKARPDMPLLNMHRKSNLANGSLPGDEQESVEALINCVVENIGFSDGKPVAAITI
YKCLLHWRTFEAEKTNVFDRLIQIFGSAMQKQDSNAELAYWLSNSSSLLIILQKSLKPAG
STITTPLKRTTTQTSFLGRMVFRASSITVDMDLVRQVEGKYPAFLFKQQLTAFVEGLYGM
IRDNVKREVSSVLSLVIQAPRTAKAGLITDQSSYWQAIVSHLNDLLKILQENCVPTIFSR
KIFTQIFAFINAQLFNSLLVRRECCSFSNGEYVKQGLEELEAWCSQSKPEYAGSAWDELK
HISQAVGFLVIFKKFRVSYDEIANDLCPILSVQQLYRICTQYWDDKYNTESVSEEVFNEM
KTLIDEGSGQGKSDNTYLLDEEISMPLSLDEIASSMDTKEFQNVVPPQELLDNAAFQFLK
S
Download sequence
Identical sequences I1GKI6
EG:BRADI1G00607.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]