SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G02240.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G02240.1
Domain Number 1 Region: 135-391
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.75e-63
Family Extended AAA-ATPase domain 0.000000223
Further Details:      
 
Domain Number 2 Region: 391-572
Classification Level Classification E-value
Superfamily FtsH protease domain-like 3.27e-60
Family FtsH protease domain-like 0.0000147
Further Details:      
 
Domain Number 3 Region: 749-936
Classification Level Classification E-value
Superfamily FtsH protease domain-like 5.23e-60
Family FtsH protease domain-like 0.000019
Further Details:      
 
Domain Number 4 Region: 557-749
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.63e-27
Family Extended AAA-ATPase domain 0.0000484
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G02240.1   Gene: BRADI1G02240   Transcript: BRADI1G02240.1
Sequence length 959
Comment pep:novel chromosome:Brachy1.0:1:1515812:1520993:-1 gene:BRADI1G02240 transcript:BRADI1G02240.1
Sequence
MAWFLAFSKAAGSVLGELHERYLPSFVGQRVRALHSQLPREFNSSDPERVLVENFERQIS
TPSALSEYVKALVCVELRNQAEKGQAWKLLWSTFGTVATTVVVVLATLVVVALVTEDYGE
SDDLKQVEASDLGTRFSDVMGVDEAKAELEDVVEYLRDSQRFTRLGAKLPKGVLLVGPPG
TGKTMLARAVAGEVGVPFFACSGSDFEEVYTGVGAKRVRELFSAAKKVSPCIIFIDEIDA
IGGRRKAEDSTWERHTLNKLLSEMDGFKQNDGIIVIGATNIPESLDKALLRPGRLDRQIH
VPMPDLEGRRQILEACLSKVLQANGVNAMTIARGTPGFSGADLANLVNDAALKAAKDGAE
AVAMHHIDYAKDRITMGSERKSATIPYKCSKNTAYHEGGHALVAIHTDGADPIEKATIVP
RGNALGMVTQLPEEGEEYQVSRKKMLATLDVLMGGLVAEELILGESEVTSGASSDLSKAT
QLAKEMVSKYGMSGRIGPVSYDYDNRGKAAAMSEWTQALVDEEVKELLDKAYKNAKKILT
EHNKELHALAKALLEHKTLTADQIMKLVSSVGQVDGSDNTPAAALGYSGSDFDDKYVGVG
AKRVRELFSAAKKLSPCIIFIDEIDAIGGRRNEHDLTWTRQTLNMLLSEMDGFMQNNGVM
VIGATNIPESLDKALVRPGRLDRVESRWRGCDGNCEGDAWVLGCRLANLVNDAALKAAKD
GAEAVVMHHIDYAKDRITMGSERKSAMVPDKCRKKTAYHEGGHALVAIHTDGAGPFEKAT
IVPRGNVRGMVTQLLEEEDDYQFSRKKMLAQLDVLMGGRVAEELILGESEVTSGASSDLS
KATQLAKEMVTRYGMSSWIGPVSYDYDDRGKVVMSERTSALVDEGVKELLDNAYKNAKTI
LTEHNKELHALANALLKHETLTGDQIMELVSPVGPVVGSDNSQQNPATPQQQSQETPSP
Download sequence
Identical sequences I1GL21
EG:BRADI1G02240.1 15368.BRADI1G02240.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]