SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G03400.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G03400.1
Domain Number 1 Region: 99-215
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 0.00000000000000405
Family N-utilization substance G protein NusG, N-terminal domain 0.0027
Further Details:      
 
Domain Number 2 Region: 270-321
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.00000000000496
Family N-utilization substance G protein NusG, C-terminal domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G03400.1   Gene: BRADI1G03400   Transcript: BRADI1G03400.1
Sequence length 324
Comment pep:novel chromosome:Brachy1.0:1:2222756:2225828:-1 gene:BRADI1G03400 transcript:BRADI1G03400.1
Sequence
MSLAYPLLRLPCRCSLPPPLASTAAMSVVSLSASAAEGEPRGRERRQQRNEARELRARDW
KEEVQERLIHEPARRRKKPPKRTWREDLNLDLLAELGPQWWLLRVSMAPGTDYVDLITKA
ISRRYSEVSFKIYNPAIEVKKRLKSGSISTKSKPLHPGLVFLYCTLNRELHDFLRDTEGC
YGFIGATRGSIKRQIKKPKPIPIEEVESIFRKEKEEQEKADKEFEELENWDNVKSFGKPV
EGTELMLINKIKKQVKKSTSKGGSGDNTSTPGASVHVLSGPFADYSGSVLEVNRKNKKVT
VQLTLFGKESFVDLDFDQIETVNT
Download sequence
Identical sequences I1GLF5
15368.BRADI1G03400.2 EG:BRADI1G03400.1 EG:BRADI1G03400.3 XP_003563433.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]