SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G04800.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G04800.1
Domain Number 1 Region: 129-190
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000000728
Family Cold shock DNA-binding domain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 69-127
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 0.000000000000301
Family eIF5a N-terminal domain-like 0.0052
Further Details:      
 
Domain Number 3 Region: 193-249
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000000857
Family Cold shock DNA-binding domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G04800.1   Gene: BRADI1G04800   Transcript: BRADI1G04800.1
Sequence length 249
Comment pep:novel chromosome:Brachy1.0:1:3190006:3195155:1 gene:BRADI1G04800 transcript:BRADI1G04800.1
Sequence
MQILRRKFLEASGGLSLHLLRSPPPARHLHRHAHAVSTFSAARGAAPAGSISATPWAATQ
RRGAKMLGSDVKLGNVIQRKGHIYQVIKAQHSHQGRGGATIQVELRDVDTGNKIVERFRT
DEALERVFVEEKSFTYLYQEGDNVALMEPNTFEQIEVSKDLFGKAAAYLKDEMRVTLQYY
DGRAVSGSVPPRVTCTVVEAQPNTKGLTAQPQYKRVLLDNGLTVLAPPFIEAGESIVITT
VDDSYVTRA
Download sequence
Identical sequences I1GLX8
15368.BRADI1G04800.1 EG:BRADI1G04800.1 XP_003559276.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]