SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G06200.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G06200.1
Domain Number 1 Region: 726-1345
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 1.15e-162
Family Molybdenum cofactor-binding domain 0.00000000322
Further Details:      
 
Domain Number 2 Region: 210-420
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-39
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0015
Further Details:      
 
Domain Number 3 Region: 589-724
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 8.37e-33
Family CO dehydrogenase molybdoprotein N-domain-like 0.00029
Further Details:      
 
Domain Number 4 Region: 97-200
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 6.41e-29
Family CO dehydrogenase ISP C-domain like 0.00029
Further Details:      
 
Domain Number 5 Region: 8-94
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 4.19e-19
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00062
Further Details:      
 
Domain Number 6 Region: 435-543
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 9.29e-16
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G06200.1   Gene: BRADI1G06200   Transcript: BRADI1G06200.1
Sequence length 1362
Comment pep:novel chromosome:Brachy1.0:1:4147825:4154917:1 gene:BRADI1G06200 transcript:BRADI1G06200.1
Sequence
MGSLGGETVVLAVNGARHEAAGVDPSMTLLEFLRTRTPVRGPKLGCGEGGCGACAVLISK
YDPATDEVTEFSASSCLTLVGSVNRCSVTTSEGIGNTRDGYHPVQQRLSGFHASQCGFCT
PGMCMSIFSALVKADKPKPGAEGEPAAPPGFSKLTSCEAEHAVSGNLCRCTGYRPIVDAC
KSFAADVDLEDLGLNSFWKKGCADVGKLPEYSAGSVCTFPEFLKSEIKSSTVDQNTGDVS
APAAIAGDGGGWYHPKSIEELHSLFESNWFDTNSVKIVASNTGAGVYKDQDLHDKYIDIK
GIPELSVLNRSSKGVEIGATVSIAKAIEVFSDGTPVFSKIADHLSKVASPFVRNTATIGG
NLIMAQRLEFASDIATVLLAAGSTVTIQTASKMQCLTLEEFLEQPPCDVRTILLSVFVPD
WSSDNVTFETSRAAPRPFGNAVSYVNSAFLARTSGDAASGGLLIEDICLAFGAYGVDHAR
RAQKVEEFLKGKSVSAPVILEAIRLLKDAISPSKGTTHPEYRVSLAVSFLFSFLSSLANN
LNEPSKDSSIPNGNGSCANGKMNGIAKNLPEKQADVASDNLPIRSRQAMVFSDEYKPVGK
PLAKAGAELQASGEAVYVDDIPAPKDCLYGAFIYSTHPHAHIKGVNFKSSLASEKVITVI
SAKDIPSGGENVGSSFPMLGDEALFGDPISEFAGQNIGIVIAETQKYAYMAAKQAVIEYS
TENLKPPILTIEDAIQHNSYFHTPPFLAPKQIGDFDKGMSEADHKILSGEVKLESQYYFY
METQTALAIPDEDNCITVYSSTQIPEVTQNVIAKCLGIPCHNVRVITRRVGGGFGGKAMK
GCHVACAVAVAAFKLRRPVRMYLDRKTDMIMAGGRHPMKVKYSVGFKSDGTLTALHMDLG
MNAGISPDVSPMLPSAIIGALKKYNWGALSFDVKACKTNVSSKSAMRSPGDVQGSFIAEA
IIEHVASTLGADTNAVRKKNLHDIDSLKVFYGDAAGDPQTYSLVDIFDKLAASPEYKQRA
AAVESFNGGSRWKKRGISCVPITYEVRLRPTPGKVSIMNDGSIAVEVGGVEIGQGLWTKV
KQMAAFGLRPLCADGEGLLDKVRVIQADSLSMVQGGFTGGSTTSETSCEAVRQSCAELVE
RLMPIKESLEATSGTAPSWSALITQATMASVNLAAHAYWKPDPAFVNYINYGAAVSEVEV
DVLTGATTILRSDLVYDCGQSLNPAVDLGQVEGAFVQGVGFFTNEEYATNADGMVINDGT
WTYKIPTVDTIPKQLNVELINSARDKKRVLSSKASGEPPLLLASSVHCAMREAIRAARKE
FAVDSPLTFQMDVPATMATVKELCGLDVVERHLESLSAAAKA
Download sequence
Identical sequences I1GMF8
15368.BRADI1G06200.1 EG:BRADI1G06200.1 XP_003557918.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]