SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G06366.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G06366.1
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 2.29e-24
Family Ribosomal protein L14e 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G06366.1   Gene: BRADI1G06366   Transcript: BRADI1G06366.1
Sequence length 134
Comment pep:novel chromosome:Brachy1.0:1:4266212:4268893:-1 gene:BRADI1G06366 transcript:BRADI1G06366.1
Sequence
MPFKRFVEIGRVALVNYGKDYGRLVVIVDVVDQNRALIDAPDMVRCQINFKRLSLTDIKI
DIKRVPKKATLIKAMEEADVKNKWENSSWGKKLIVQKRRASLNDFDRFKVMLAKIKRGGA
IRQELAKLKKEVAA
Download sequence
Identical sequences I1GMH6
EG:BRADI1G06366.1 XP_003558070.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]