SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G08880.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G08880.1
Domain Number - Region: 41-205
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0111
Family NRPS condensation domain (amide synthase) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G08880.1   Gene: BRADI1G08880   Transcript: BRADI1G08880.1
Sequence length 466
Comment pep:novel chromosome:Brachy1.0:1:6283237:6285467:1 gene:BRADI1G08880 transcript:BRADI1G08880.1
Sequence
MPTAAAATAAGMATGPGSRVTRYAKSTAASVTPVRPGKTHALSALDNAMEWHAVHLVLYC
RAAPGVGRDALKESLSEALSLYPAMTGRLVRAAQGEEGGAAGGWIVKCNDAGVRTVDATA
AVTLDEWLATASADEEMDLAYFEQMGAEPYIWSPFYVQLTEFTDKSYALGLSCTHVHNDP
TAASLFFHGWAAAHRRATSPYPPFLHSPSFAVSPTTPPSPPPLLAAKSTAAPAPPNSDAA
MSSATFHFPAAAMRALLSSLEPGATPFAALAALFWLRVAGHDAAESRQKELTLALDFRKK
MRAPLPTGYYGSAVHFTRARADLSSPLAAVAAALDACVAGVPEEELWAALEWLHARQASA
PGGGGGGEPFQMYGPELTCVALDHVPMYGTEFVAGEPPARVACRVGGAEGEGVVIVMPAA
EGGEARDVVVTLPADAAARVCRDGELLRYGARVVAGSKVETGPKAQ
Download sequence
Identical sequences I1GND7
15368.BRADI1G08880.1 EG:BRADI1G08880.1 XP_003559747.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]