SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G08917.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G08917.1
Domain Number 1 Region: 2945-3232
Classification Level Classification E-value
Superfamily BEACH domain 1.44e-121
Family BEACH domain 0.0000000251
Further Details:      
 
Domain Number 2 Region: 3286-3485,3517-3561
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.44e-28
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 3 Region: 2752-2795,2855-2918
Classification Level Classification E-value
Superfamily PH domain-like 9.84e-17
Family PreBEACH PH-like domain 0.047
Further Details:      
 
Domain Number 4 Region: 1067-1258
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000211
Family Laminin G-like module 0.059
Further Details:      
 
Domain Number 5 Region: 482-619,672-783,919-978
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000358
Family Armadillo repeat 0.055
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G08917.1
Domain Number - Region: 17-31
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0575
Family Formin homology 2 domain (FH2 domain) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G08917.1   Gene: BRADI1G08917   Transcript: BRADI1G08917.1
Sequence length 3566
Comment pep:novel chromosome:Brachy1.0:1:6309163:6326121:1 gene:BRADI1G08917 transcript:BRADI1G08917.1
Sequence
MKWSTLLSKVVFAAPQPPPPPPPPASPLHQQGDQADPDSATPRLSSASTSGSGAGDDGGF
AAAFDAASGSSPSSATSSVRGKNELESDFRRFWEEFRSSSSEKEKERALNLAVDVFCRLV
KQHSSVAQLVTKLVEAHVFAFVIGRAFVTDVEKLRIHSKGRSLHVADVIGFFSEITELGI
CPGSNLLYAVEVLVTETIDKQPLLDSGILCCLIYILNSLLSPHESFKKSSPVGGEESASE
KNKDWDPIQSRRLEIEASVVHIMKALASHSSAAPSLIEDDALQLLFHMVANGSVSVFSQF
REGLVPLHTIQLHRHAMQIKVLLMAVKDFKPQSGDAAYTIGIVDLLLECVELSYRPEAGS
IRLREDIHNAHGYQFLVQFALTLCSLHKNQAHQSLPKLASEEDVLDSSGRLEQDTFPCDL
SPQLSRLLDVLVNLSQTGPYEDYVGKSIKSSHGKGAGHSRSRTPSADKFADEVLEISSPK
VKDLEAIQMLQDIFLKADNLEVQAEVLNRMFKIFSSHLENYKLCQQLRTVPLFILNMGGF
PPALQEVILKILEYAVTVVNCIPEQELLSLCCLLQQPISTNLKHTVLSFFVKLLSFDQQY
KKVLREVGVLGALLDDLKQNKLFSGDEQQSKIFYSPEIRSNTDDFQKTVDNKDSILSPKL
MSSGSTKFPMFDDEGTITVAWDCLFYLLKRADTNQQSFRSSNGVNTILPFLVSESHRSGV
LRLLSCLIIEDSLQAHPEEIGSLIEILKSGMVSTSLGSQYKLDNDAKCDTFGALWRILGA
NSSAQRVFGEATGFSLLLTTLHSFQNEGENEETEHSLFTHMKIFGFLMRAMTAAVCNNAV
NRIRLHTILSSHTFYDLLSESGLLCVDCEKQVILLLLELALEIVLPPTSNLQVESLSETS
EDESGFLSATSFGLSRLDGERAYNASAVVVLIRSLLVFTPKVQLELLRFIEKLASAGPFN
QENLSSVGCVGLLLETINPFLEGSSPILNHALKIVEVLGAYRLSSSELRLLVRYILQLKV
KRSGHLFVNMMDKLIQMEDVRQGDISLAPFIEMDMSKAGHASIQVSLGERTWPPVSGYSF
VCWFQFRNFFRSHSKEADKTSKGASGKRSGQVLRIFSVGTVDDANTMYAELYLHDNGVFT
IATSNSSSLSFPGIEMGEGKWHHLAVVHSKPNALAGLFQASVASIYLDGKLRHTGKLGYS
PSPFGKSLQVTLGTPAIRGKVSDLSWQLRCCYLFEEVLTPGSICFMYILGQGYRGLFQDT
DLLRFVPNRACGGEVMAILDSLEVEVTAPSSSQRIDSSMKQVNSRLESSGIVWDMERLRN
LSLQLSGRKLIFAFDGTSSDAFRASGTLSLLNLVDPTSAAASPIGGIPRYGRLSGDVYVC
NQCTIGDTVQTVGGMPVVLALVEAAETRDMLHMALELLALSLLQSHQNVKDMQALRGYHL
LALFLHRRMSLFDMQSLDIFFRIAACEASFPEPQKSNINRTASYASGISPEASLDDLSLP
KFSDDVSSVGSHGDLDDFSGQKDSFSSHLSELENADLAGETSEFIVLSNADMVEHVLLDW
TIWVGAPISVQITLLGFLERMVSMHWFRNHNLTILRRINLVQHLLVTLQRGDVEIPVLEK
LVVLLGVILEDGFLASELELVVRFIIMTFDPPELTPNRQIVREAMGKHIIVRNMLLEMLI
DLQVTINTEELLEQWHKVVSSRLVTYFLDEAVHPTSMRWITTLLGVCLTSSTTFALKFRT
SGGFQGLNHVLPSFYDSPEIYYIIFCLVFGKPVYPRVPEVRMLDFHALMPSDGNYGELKF
VDLLDTVIAMAKATFDSFIMKSMLAHQNNDLSHLNGTLVADLVEATSDMGGDLQGEALMH
KTYAARLMGGEAAAPAVATSILRFMVDLAKTCPPFSAVCRRHDFLDSCVDLYFSCVRSDC
ALKMAKDLTTAATDEKHMNDDDNESSKDTFSCLPQDQEQSSKTLSAASFPQEHKSTSSES
TDMQNSSDNGEVKADSSPSEELSTKFVNGETKQVFKNVHDQGQLPAVRSNGIADSHQLAD
SPSPVSMINIGSPVLSERSTHKAASTPTASPMAPFTSWAGSTGSYTDGRHLTASPSMSST
ISAMDLDSSPDLKTNIQGSTAVNSFFPINSKLLLDIDDLGYGGGPCSAGATAVLDFIAQI
LADIISEQLKATLFIESILESAPLFVDVDSALVFQGLCLSRLMNFLERKLLLDDEEDGKK
LDKSRWSVNLDPLCYMIVDRVYIGCFPTPLGVLRTLEFLMSMLQLANQDGRIEDAVPSGK
GILSIARGTRQLDPYIHAILKNTNRMIMYCFLPTFLKNLGEDDLLANLAFLTETGRNLAS
KPPHEDYSLDICTILQLLIANKRLVLCPSNVDTDLMCCFCINLMALLRDERLTAQNLAVD
LLKYLVVHRRPSLEELLVCKPNQGQQTDILHGGLDKLLTGSTSMFFEWLQNSQQTISKVL
DQCALIMWVQYITGSAKFPGVRIKGMEVRRKKEMGRKSREIIKLDGRHWEQINERRYNLD
LVRDVMSTELRAIRQDKYGWILHGESEWQSQLQQLVHERGIFPIRQLSLEPEWQLCAVEG
PYRMRKKLENSKFKIDTIQNVLSSSLGFDDFTMSKKDDGDMLMTSGSDTMSGLNLVTYDT
EQREIDAAEFTSFKDDDDIFKGGSTMSPPIGWTDDKSSINEQSLHSATDFGAKSSSFSYH
MTESVQGKSEFNSPRQPPSVKGTDTRTSEDKSEKELLDNGEYLIRPYLEPSEKIRHKYNC
ERVAGLDKHDGIFLIGDLCLYIIENFYIDDSNCICEKGDQDELSVIDQALGVKKDIMGSI
DSQQKSPSPWGATAKILLGGRAWAYNGGAWGKEKLCSSSNLPHPWHMWKLDSVHELLKRD
YQLRPVAIEIFSMDGCNELLVFHKKEREEVFKNLIAMNLPRNSMLDTTISASSKQDSGEG
SRLFKVMAKSFSKRWQSGEITNFQYLMHLNTLAGRGYSDLTQYPVFPWVLADYESNTLDL
TNPQTFRKLDKPMGCQTEGGEEEFRKRYDSWDDPDVPKFHYGSHYSSAGIVLFYLLRLPP
FSTENQKLQGGQFDHADRLFNSVKDTWVSAAGKSNTSDVKELIPEFYYLPEFLENRFSLD
LGEKQSGEKVGDVVLPPWAKGSTREFISKHREALESDFVSENLHHWIDLIFGYKQRGKAA
EDAVNVFYHYTYEGNVDIDAVSDPTMKASILAQINHFGQTPKQLFQKAHPQRRTDRKVPP
HPLRYSAYLTHQEIRKTVSSVSQIVSYNDKILIASANSLLKPVTYSEYISWGFPDRSLRI
LTYDQDRLQSTHENLHGGSQIQCTGVSHDGNILTTGGDDGVVAVWRFVKDGIRRLLRMEK
ALCAHTAKITCVYVSQPYSLIVSGSDDCSVILWDLTSLVFVKQLPKFPASVSALHVNNLT
GEILTGAGVLFAVWSINGDCLAVVNTSQLPSDLILSVASTTHSDWQDTNWYVTGHQSGAV
KVWKMVHCTSDEAANNKSKSPPTSYGGPDLNGQTLEYRLLLQKVLKSHKHPVTALCLPPD
LKQLLSGDASGRLFSWSLKDDSFKGS
Download sequence
Identical sequences I1GNE4
EG:BRADI1G08917.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]