SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G10530.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G10530.2
Domain Number 1 Region: 788-872
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000000113
Family Protein kinases, catalytic subunit 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G10530.2   Gene: BRADI1G10530   Transcript: BRADI1G10530.2
Sequence length 901
Comment pep:novel chromosome:Brachy1.0:1:7619237:7623545:1 gene:BRADI1G10530 transcript:BRADI1G10530.2
Sequence
MAENIDLVLDFLRKNRFAKAEAALIGELSGLGDVNRSATQRRATEPKEDDEQEDSEVGST
AGPRGAASVRSADSSREFIVKEIDVGGLPNGSDEKKGLGIGLPQDNNTGDLYPWNFSIAN
STVEQLAELLVSEEVPRHRRGALVAEKRDRGVGTEQPGPVLEQKVSFGRGKGKVELARRS
EISEPAHSSDKNLVPEKEEPLNGYAVKTVLPFPTEIPSSSYHSTHHDVNERKETKKSIGA
DGAGKAAKRQPDEGNRQYYSEKSQNNVDQISDRCFDLQLMGNNQREEFPKLPPVRLKSED
KLVNMNWEEKIDHHESGTNDPSADHVFMIGSYLNVPIGQDITSSGGRRTIGGNSWLSVSQ
GIAEDTSDMIFRTMGDDFEYPNNEYWDSDEYDDDDDVGYTRQPIEDETWFLAHEIDYPSD
NEKVTGHTSAPDRHDRPTKDDDDDQSFVEEDSYISGEQYFHGKNIAQIGTSEGPIGHGIP
DNDMIAQYDGQLLDPEELNLMHSEPVWQGFVSQNSELGMLGNGKFLNDSERPNPDDPFVE
DDQHGSVRSIGVGISSDAADIGSEVRESLIGGSSEGDIEYFNESNVSVSGKRHSQQETEK
KRLNVNGAKHDQMNYDTQKGNLPPGAAFGDAGFSFPPPLHSGKNTESDVKSSWSKKDDVY
SINDPDDCQNGTVSDDTLATWKKKNSESSLRSSRDEMTSDVVRSRNSSASSALNNAYDEV
EETLIARHHKLDDAQEEETGTTLDDEEAAALQEQVRQIKAQEEEFETFNLKIVHRKNRTG
FEEDKNFHVVLNSVIAGRYHVTEYLGSAAFSKAIQAHDLHTGMDVCVKIIKNNKDFFDQS
LDEIKLLKYVNKHDPADKYHLLRLYDYFYYRVNISFYLLPILFQCYLAPVEHVIYQFFLL
Q
Download sequence
Identical sequences I1GNY0
EG:BRADI1G10530.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]