SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G10970.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G10970.1
Domain Number 1 Region: 356-636
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.05e-82
Family Protein kinases, catalytic subunit 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G10970.1   Gene: BRADI1G10970   Transcript: BRADI1G10970.1
Sequence length 646
Comment pep:novel chromosome:Brachy1.0:1:7973279:7979810:-1 gene:BRADI1G10970 transcript:BRADI1G10970.1
Sequence
MFSWSRKQSSPSSSSGGRRADASMDSSSRRSGGSGSGSGSRGRSPRLERRNAAKHIDYEA
GAGASSSVSASWSSSSSSAERSPGIRPSRSLDLAARGGTDFRISGSAEGEVDELCRSLGL
SGPEEFAIPVAAWEARKARSSSDLTRSRPDSSTPVEDPSPVVRSISAPEPQCPPPLSFPD
PIPEEPLHSSSTSTATDSVEEPTIAAPEESPKATPVVAVVVPVAGLSPLSPRRGGGEVGI
RGVRPPVLSPPPPITGLALPPVRRSSVADVMSGSAWDIVQSFAPMEEQIEPAMSYEHVDT
SHMSDTEEGEDEETEEGVTGAERELKGWRVGETFEGFTGTSSLSTTNDDDASSTNTEAVF
IISPNGKFKRNIKSWMRGALLGSGSFGMVYEGISDEGAFFAVKEVSLLDQGSNAQQSILA
LEQEIALLSQFEHENIVQYYGTDKEESKLYIFIELVTQGSLSSLYQKYKLRDSQVSAYTR
QILNGLVYLHERNVVHRDIKCANILVHANGSVKLADFGLAKEMSKINMLRSCKGSVYWMA
PEVVNPRKTYGPAADMWSLGCTVLEMLTRQIPYPDVEWTNAFFMIGRGERPPIPSYLSKE
AQDFISQCVRVDPEERPSASQLLAHPFVNRPLRASFDSLSPPTNRS
Download sequence
Identical sequences I1GP25
EG:BRADI1G10970.1 15368.BRADI1G10970.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]