SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G11027.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G11027.1
Domain Number 1 Region: 426-803
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.57e-118
Family Oxysterol-binding protein 0.00066
Further Details:      
 
Domain Number 2 Region: 94-131,173-232
Classification Level Classification E-value
Superfamily PH domain-like 2.6e-19
Family Pleckstrin-homology domain (PH domain) 0.028
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G11027.1
Domain Number - Region: 45-54
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0126
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G11027.1   Gene: BRADI1G11027   Transcript: BRADI1G11027.1
Sequence length 808
Comment pep:novel chromosome:Brachy1.0:1:8029295:8038797:1 gene:BRADI1G11027 transcript:BRADI1G11027.1
Sequence
MHPFCCVPAPVSVSPAASVANSSAAAAAAASSAAAGLPAVVPPSPPPPPPMPPPSTRSTS
SGGERRARVPGVGGGGSSSPPEGVKLNEIVGGGISGVLYKWVNYGRGWRPRWFALHDGVL
SYYKIHGPDRIVLSRDTERGAKVIGEDSLRRLSRPSTSSSSSHSNGHHPPRKPLGEIHLK
VSTVRESRSDDKRFSIFSGTKRLHLRAETREDRAAWLEALRATKEMFPRMSTSEMVGPGD
TAAAVAVSTERLRQRLQQEGVSETAIADSERIVRAEFEALHKQLVLLKQKQAFLLDTLRH
LETEKVDLENTLVDESQRQSKEYGSASRPKNEKYSEGSASESDDYNEPQDPAEEETDDEE
NIYFDTTDFLSSSSFKSSGSDFQRSEAGSDNEDDYPMDGIDPSMKSVGINYPYVRRRKKL
PDPVEKEKGVSLWSMIKDNIGKDLTKVCLPVYFNEPLSSLQKCFEDLEYSYLIDRAYEWG
KRGNSLMRILSVAAFAVSGYASTDGRSCKPFNPLLGETYEADYPDKGLRFFSEKVSHHPM
VVACHCEGTGWRFWADSNLKSKFWGRSIQLDPVGMLTLEFDDGEVFQWSKVTTSIYNLIL
GKLYCDHYGTMRIQGNREYSCKLKFKEQSIIDRNPHQVQGVIQDRSGRTVATLFGKWDES
MHYVMGDCFGKGKGSENFSEAHLLWKRSKPPKFPTRYNFTSFAITLNELTAGLKEKLPPT
DSRLRPDQRCLENGEYERANAEKLRLEQRQRQARKMQESGWKPRWFAKDKGTDTYRYVGG
YWESRENSCWDGCPDIFGQLPNDLMITD
Download sequence
Identical sequences I1GP33
EG:BRADI1G11027.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]