SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G11317.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G11317.2
Domain Number 1 Region: 1570-1920
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.63e-77
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.0000495
Further Details:      
 
Domain Number 2 Region: 1371-1540
Classification Level Classification E-value
Superfamily ARM repeat 3.57e-40
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.0088
Further Details:      
 
Domain Number 3 Region: 277-484,567-606,758-885
Classification Level Classification E-value
Superfamily ARM repeat 0.000000251
Family PBS lyase HEAT-like repeat 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G11317.2   Gene: BRADI1G11317   Transcript: BRADI1G11317.2
Sequence length 1927
Comment pep:novel chromosome:Brachy1.0:1:8360691:8378118:-1 gene:BRADI1G11317 transcript:BRADI1G11317.2
Sequence
MEALNELCDLVAANPDLLLADKLTWLSSRCAPASSSSPQRASRAHLHSLLALARLLPAGA
AGGSPPPPLLAFLSSHAFLSPAFWPQSFAPAPFLSKLLPLLASAPASPALSSALSSAILA
ALDVADPASAPLARAFLSAVAANPPQLLPADSAPVGERLLLEFPASEEAPPRAKGKGEDA
AGEENGGIKEVVQRFEEEGVEVLERKEVAFRLLVHMMGGEGGLEADKVVKVRNAAARQVR
SLTDFLKIRKRDWREQGPQLKARINTKLLCCQAAVVVLVRSVSAMETDSKSSKDMLQQTL
AWFIEATKSCILSSWRKLKVCEELFCTLLNGISQITVSRGGQLLPVLLIPLKPLVVSTCS
QADMTGCSPGALFEAVVKLSCEIIEFGWTKDRALVDTFIMRLAAYVRERNDYEEEDGKGK
EAVPLMRLNVVRLLAELCVCLKRWEVVDMILPLFIEHLEEGDASAPSLLRLRLLDAISRV
ACLGFEKSYRESIVLMTRSYLDKVKAVGSADNNTLPTEATTERSETLPAGFLLVASNLTS
TKLRSDYRHRLLSLCSDVGLAAESKSGRSGADLMGPLLPAVAEICSDFDTVSSVEPSLLK
LFRNLWFYIVLFGLAPPIQNNQTPSKPVSTPLNTVEGVSSVALQAVAGPYMWNSQWSVAV
QRIAQGTPPLVVSSVKWLEDELELNALHNPGSRRGNGDEKAAVGQRTALAAALGGRVEVA
AMSTISGVKATYLLAVAFLEILRFSCDGGILSSTSTLNKSNSAFSCVFEYLLTPNLTPAV
TQCLTAVVHRAFEAMLSWLEDRISDIGEGADVRESVLSGHACFLIKSMSQRDEHVRDVSV
KLLTQLKEKFPQILWNSSCLDLLLISVHNELTSGPVSDPAWVATVRSLYQKIAREWITSA
LSYAPCTTQGLIQENFCKPSGAQRTQHTADVVSLLSEIRICTGKNDWSGIRTANVPAVMD
SAAAASGARKEAPDITLEVLSTAVVSATAKCNHAGEIAGMRRLFSTMGGLNMGTSPGTQS
GQAPQSFDEVFLSKFVRLLQDFVVTAEKQQIDNSQFRETCSQATALLLDHMVSDTRTNLE
GFSQLIRLLCWCPAYISTPDAMETGIYIWTWLVSAAPSLGPLVLAELVDAWLWTIDTKRG
LFASDMKYCGPDAKLRPHLIPGEPETPPEKDPVEAIIAHRLWLGFFIDRFEVVRHDSVEQ
LLLLGRMLQGTMRSPTHFSHHPAATGTFFTAMLLGLKFCSCQSQSNLQRCNMGLQLLEDR
VYRAALGWFAYAPEWYESQNKSFAQREAQSVSLFVHNLQNTSSPSDSGSKSQGREGELNT
ADQIHPVWGSVDNYATAKEKRKQLLLMLSQNEADRLEVWANPINTKDTTTFRGKISSDKW
TDHSRTAFAVDPRIALSTAMRFPTNAVLQSEITQLVQTHILELRTIPEALPFFITPKAVD
ENSALLQQLPHWAPCSVTQALEFFTSPYKGHPRVMAYVLRVMETYPPETVTFFMPQLVQS
LRYDDGKLVEGYLLGAARRSNIFAHILIWHLQGECEESDNEKEAGAPKTSAFQSLLPAVR
EKIVDGFTPDARDMFEREFDFFDKVTSISGVLFPLPKEERRAGIRRELEKITIPGDDLYL
PTATNKLVRGIQLDSGIPLQSAAKVPIMITFNVIDRDGNPNDVKPQACIFKVGDDCRQDV
LALQVIALLRDIFEAVGLNLYLFPYGVLPTGPERGIIEVVPNTRSRNQMGETTDGGLLEI
FQQDYGPVGSPSFEAAREMFMISSAGYAVASLLLQPKDRHNGNLLFDSHGRLVHIDFGFI
LEISPGGNMGFESAHFKLSHEMTQLLDPSGTMKSDTWNQFLRLCVKGYLAGRRHMNGIIT
TVQLMVDSGLPCFSRGEPIANLRKRFHPEMNEREAANFMVRTCVDAYNKWTTAGYDLIQY
LQQGIEK
Download sequence
Identical sequences I1GP69
EG:BRADI1G11317.2 XP_010231085.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]