SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G12000.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G12000.1
Domain Number 1 Region: 136-216,268-325
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.01e-23
Family Galectin (animal S-lectin) 0.0078
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G12000.1
Domain Number - Region: 400-502
Classification Level Classification E-value
Superfamily Chalcone isomerase 0.034
Family Chalcone isomerase 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G12000.1   Gene: BRADI1G12000   Transcript: BRADI1G12000.1
Sequence length 603
Comment pep:novel chromosome:Brachy1.0:1:8916292:8921242:1 gene:BRADI1G12000 transcript:BRADI1G12000.1
Sequence
MRRPRRAACGLRPLLLLLPLAALLSFATFSLHYPDRLVGPTTVAVAAAVADTAHPQVPSP
RHRLEISRLDLRALNATPPLHAAAVRAFRTGGRLLRDALSVSAGAAPPHARSPDSPRCPP
SVALSGGKLRAAGNALALPCGLALGSHVTVVASPRKVPGNGLAQFAVELRGAGHGDAAST
ILHFNPRLRGDWSGRPVIEQNTRFRGQWGPALRCEGWRSRSDEETVDGLVQCEQWAWNTA
DTFEELKMIWIRNRVVGQRSKDLIDWPYPFVEDELFVLTLSAGLEGYHVQVDGRHVTSFP
YRVGFILEDAAILQVNGDIEVESMVAGSLPRAHPNIAERNLELLAELKAPPTEEPVELFI
GILSAGSHFTERMAVRRSWMSAVRNSSSTMARFFVALNERKEVNEDLKKEANFFRDIIIV
PFVDSYDLVVLKTVAICEYAARVVSAKYVMKCDDDTFVRLDSVMAEVKKIPDDKSFYVGN
MNYYHRPLRKGKWAVSYEEWPKDTYPPYADGPGYIVSSDIANFVVFEMETGRLNMFKMED
VSVGMWVGQFNGSVKAVEYAHSVRFCQFGCVDDYLTAHYQSPGQMLCLWEKLGRGKPQCC
NAR
Download sequence
Identical sequences I1GPE9
XP_003561075.1.954 EG:BRADI1G12000.1 15368.BRADI1G12000.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]