SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G12050.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G12050.1
Domain Number 1 Region: 7-148
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.4e-30
Family Staphylococcal nuclease 0.0068
Further Details:      
 
Domain Number 2 Region: 580-713
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.31e-27
Family Staphylococcal nuclease 0.002
Further Details:      
 
Domain Number 3 Region: 180-229,272-365
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 4.84e-25
Family Staphylococcal nuclease 0.0024
Further Details:      
 
Domain Number 4 Region: 374-557
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.57e-21
Family Staphylococcal nuclease 0.015
Further Details:      
 
Domain Number 5 Region: 774-855
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 4.06e-17
Family Tudor domain 0.0035
Further Details:      
 
Domain Number 6 Region: 817-972
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 1.18e-16
Family Staphylococcal nuclease 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G12050.1   Gene: BRADI1G12050   Transcript: BRADI1G12050.1
Sequence length 987
Comment pep:novel chromosome:Brachy1.0:1:8951229:8958807:1 gene:BRADI1G12050 transcript:BRADI1G12050.1
Sequence
MASNTGASGWLRGKVKAVTSGDCLLIMGSTKAEIPPEKSITLSYLMAPRLARRSGVDEPF
AWQSREFLRELCVGKEVTFRVDYTAPNIGREFGTVYLGDKNVAYSVVSAGWARVKEQVPK
GGEQSPYLAELQRLEEVAKQQGLGRWSKEPGAAEESIRDLPPSAIGESSGFDAKGFAVAN
KGKSLEAIVEQVRDGSTIRVYLLPSFQFVQIYVAGVQAPSMGRRPPNPTVVTEAEGTADA
TNGDDSGETPAPLTTAQRLAASAVSTEIPPDRFGREAKHFTETRVLSRDVRIVVEGTDSF
NNIIGSVYYPDGDTAKDLSLELVENGLAKYVEWSANMLDVEVKIKLKSAELKAKNEQLRI
WTGFKPPVTNSKPIHDQKFTGKVVEVVSGDCIIVADDAAPHGSPSAERRVNLSSIRAPKL
GNPRKEEKPANFARESKEFLRTRLIGKQVTVEMEYSRRISTMDGQNVLSSSNAADTRVLD
YGSVFVGSPSLASGDDTSSITSPGNQPRINVAELLLSRGFAEISKHRDYEERSHYFDALL
AAHSRAEKAKKGLHSGKLSPVMHITDLTIVSSKKAKDFLPFLQRNKRHTAIIEYVFSGHR
FKLTIPKETCSIAFSLSGVRCPGKDEPYSSEAIALMRRMILQRDVEIEVEAVDRTGTFIG
SLWESRTNMSSVLLEAGLAKLNSFNLDRIPDAHVLTRAEQSAKQQKLKIWENYVEGEEVS
NGSASESKQKEILKVVVTEVLGGGKFYAQTVGDQRVSSIQQQLASLKLKDAPVIGAFNPV
KGEIVLAQFSLDNSWNRAMIVNGPRGAVESVDDKFEVFYIDYGNQEVVPYSRIRPADPSV
SSSPALAQLCSLAFIKVPGLEDDYGQEAAEYLSECLLSSSKQYRAMIEERDTSGGKSKGQ
GTGPILIVTLVDGEAESSINAAMLEEGLARLERSKRWDTKERKTALNNLEQFQEKAKKER
LRLWQYGDVESDEEEQAPGARKPGGRR
Download sequence
Identical sequences I1GPF5
EG:BRADI1G12050.1 15368.BRADI1G12050.1 XP_003561080.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]