SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G12140.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G12140.1
Domain Number 1 Region: 319-397,483-564,632-646,691-806,870-1008
Classification Level Classification E-value
Superfamily Phosphoglycerate mutase-like 1.44e-48
Family Histidine acid phosphatase 0.015
Further Details:      
 
Domain Number 2 Region: 95-310
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000000000000707
Family Lysine biosynthesis enzyme LysX ATP-binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G12140.1   Gene: BRADI1G12140   Transcript: BRADI1G12140.1
Sequence length 1044
Comment pep:novel chromosome:Brachy1.0:1:9041294:9060555:-1 gene:BRADI1G12140 transcript:BRADI1G12140.1
Sequence
MAVDDNEGADRVTIGVCVMEKKVFCSPMEQILERLRAFGEFEIIIFGDKVILEDPIEIWP
KCDCLIAFCSSGFPLQKAQAYAALRRPFLVNELEPQYLLHDRRKVYEHLEKYGIPVPSYA
LVNREYPYQELDHFIEQEDFVEIHGKRFLKPFVEKPANGDDHRIMIYYPNSAGGGMKELF
RKVGNRSSEFHPDVRRVRREGSYIYEEFMPTGGTDVKVYTVGPGYAHAEARKSPVVDGVV
MRNPDGKEVRYPVLLTPTEKQMARDVCSAFRQMVCGFDLLRCDGRSYVCDVNGWSFVKNS
YKYYDDAACILRKIFLDAKAPHLSSIIPPTLPWKSNEPDQSTEGLTRQGSGIIGTFGQSE
ELRCVIVVIRHGDRTPKQKVKLKVTEENLLNLMLKYNGGKPRAETKLKSAVQLQDLLDAT
RQLVPPTRSGQESDSDAEDLEHIEKLRQVKAVLEEGGHFSGIYRKVQLKPLKWIKVPKHN
GDGEEERPIEALMILKYGGVLTHAGRKQAEELGRFFRNNIYPGEGTGLLRLHSTYRHDLK
IYSSDEGRVQMSAAAFAKGLLDLEGQLTPILVSLVSKDSSMLDGLEDASIEMDEAKARLH
EIIISNAKTENTNGSEEFPWMVDGAGLPANASQLLPKMAKLTKEVTAQVKLLAEGEDEKL
ALTSSFSRYDQAKALGKTTIDVARIAAGLPCGSESFLLMFARWKKHERDLYNERKDRFDI
TQIPDVYDSCKYDLVHNAHLNLEGLEELYKVAQLLADGVIPNEYGINPAQKLKIGSKIAR
RLMGKVLIDLRNTREEAICVADPNFTEDEAIFLPTKELEHQQKIQLRNEDGRRSSTTSEK
SMDQEDEDDRETKYRLDPKYANVKTPDRHVRTRLYFTSESHIHSLMNVLRYCNLDESLQG
EDSLVCQSTLDRLHRTRELDYMSNIVLRMFENTEVPLEDEKRFRIEMTFSRGADLSPLED
KTSETSPLLQEHTLPIMGPERLQEVGSCLTLDKFEKMVRPFAMPPEDFPPAAPPQALGYF
SKGAGVLERLASFWPFHKGVTNGK
Download sequence
Identical sequences I1GPG4
EG:BRADI1G12140.1 XP_003561142.1.954 15368.BRADI1G12140.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]