SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G12910.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G12910.1
Domain Number 1 Region: 30-130
Classification Level Classification E-value
Superfamily PH domain-like 1.69e-16
Family Pleckstrin-homology domain (PH domain) 0.0049
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G12910.1
Domain Number - Region: 262-305
Classification Level Classification E-value
Superfamily BAS1536-like 0.0235
Family BAS1536-like 0.0064
Further Details:      
 
Domain Number - Region: 206-267
Classification Level Classification E-value
Superfamily Peptide deformylase 0.0334
Family Peptide deformylase 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G12910.1   Gene: BRADI1G12910   Transcript: BRADI1G12910.1
Sequence length 500
Comment pep:novel chromosome:Brachy1.0:1:9790086:9794868:1 gene:BRADI1G12910 transcript:BRADI1G12910.1
Sequence
MATNGSSPRVRDTESSLEKVKRQLSSGSGRYLLQGPLLKRSETLRKWNERWIILDPTSGK
MEYKLRRNETAIKGTILFDASSTITLSPVNFQGMPKYDGCCFYIGTPQKKDYFLCAETPG
AAKAWVSTLHATQLVLQAHKEAVNSLAGNGSPSTLGTVATAVANANATALEAMKEIEAAL
KVSMRAAFGLGTNNLNEGQLDDLTIMKETLRVKDEELQHLAKDIRARDATIQEIADKLTE
TAEAAEAAASAAHTMDEQRRLLCSEIERLKKAMETQMEQSMLKLRLSEEKVISLSKEKDQ
LLKERDAAFQEAHMWRTELGKAREQAVIQEATIARAEEKVRVCEADATVRIKEAAENLYA
VEKEKEELLALIGVLQSQVQREQSSTKQVCEERSESCSGADNSPPLTKHVDASDDDVDKA
CVSDSRSVLVSNDSTEVQLAVDGVDIRPIGDAEWGGFQQSEALIADVREVSPEAEGSSLD
IPVVNPPPVNDCIQGGATHP
Download sequence
Identical sequences I1GPQ9
EG:BRADI1G12910.1 XP_003561472.1.954 15368.BRADI1G12910.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]