SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G12940.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G12940.1
Domain Number 1 Region: 128-209
Classification Level Classification E-value
Superfamily ARM repeat 0.0000051
Family HspBP1 domain 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G12940.1   Gene: BRADI1G12940   Transcript: BRADI1G12940.1
Sequence length 238
Comment pep:novel chromosome:Brachy1.0:1:9803859:9808448:-1 gene:BRADI1G12940 transcript:BRADI1G12940.1
Sequence
MSRVACLRLRASAATPPFPSRCLAAPQPPRSVSRLPPRASDSTAGKNQGRATALPCPTGS
SALGWSGESGLRLYRRFCTYDERDDRALEEEFERKFGWMLKIFFLGTAGLVGWQFFPYMG
DNLLQQSISLLHVKDPLFKRMGASRLARFAVDDERRMKVVEMGGAQEILNVLEGAKDDKT
RKEALKALVALSKSDKAAGFLDKAGAYAIVSSTPNSPEYAEIEACKTRLLKAFDQLKS
Download sequence
Identical sequences I1GPR3
XP_003561480.1.954 15368.BRADI1G12940.1 EG:BRADI1G12940.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]