SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G13730.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G13730.1
Domain Number - Region: 108-204
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000695
Family CAT-like 0.021
Further Details:      
 
Domain Number - Region: 315-455
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.00823
Family NRPS condensation domain (amide synthase) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G13730.1   Gene: BRADI1G13730   Transcript: BRADI1G13730.1
Sequence length 470
Comment pep:novel chromosome:Brachy1.0:1:10578487:10580130:1 gene:BRADI1G13730 transcript:BRADI1G13730.1
Sequence
MAEGEDTSFCSPSAGGGLRLRVLDTAVVTPAAPPLPPCSLPLTYLDMQWIHSPPVERVFF
FQSSPDTGLISRLKDSLSTALRLFFPLAGRLRIATGTATTARHHILYQPGDGVAFTLAEY
DADLSDLASDHRPRKVSELAHLVPPLQPTEGGAALLAVQATVLLRSDRPGLALGVTVHHA
ACDGAGSTSFLHAWAAACAGPGADDESFVFRQPPVIDRTLIAEPQGLYDHYARNLLSTDE
IEFVKMSPDQVLATFTLSIEHLQGVKDAVAGEAVRRGQTPPPGCSTLVAALGFIWSCYCR
AQATDSAGGGIEPAYFIVPVDHRKWMKPPVPAAYFGNCIGPGIGAAPKKELASGGAGGLL
AACAAIAAGVEKAVASPEWETLVERIKEVGARGVLSVAGSPRFRVYDVDFGFGRPAKVEI
VSVARTGAMAVAEGRSCVGMEVGISLPPAGMEAFQRCFADAIAWLSSSSH
Download sequence
Identical sequences I1GQ06
XP_003559638.1.954 EG:BRADI1G13730.1 15368.BRADI1G13730.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]