SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G14410.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G14410.1
Domain Number 1 Region: 208-437
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.91e-88
Family CAT-like 0.000000143
Further Details:      
 
Domain Number 2 Region: 71-160
Classification Level Classification E-value
Superfamily Single hybrid motif 1.96e-23
Family Biotinyl/lipoyl-carrier proteins and domains 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G14410.1   Gene: BRADI1G14410   Transcript: BRADI1G14410.1
Sequence length 438
Comment pep:novel chromosome:Brachy1.0:1:11336074:11340165:1 gene:BRADI1G14410 transcript:BRADI1G14410.1
Sequence
MASRIAARLLLRRPTAALSFLQSCRHARHFSTQLLEGVPRFSKPTRARYFLPNASPYQLW
SRSFASENGDLIEAVVPFMGESVTDGTLANFLKKPGDRVEADEAIAQIETDKVTIDVSSP
EAGVIEKFIASEGDTVTPGTKIAVISKSAAPSETHVSPSEETSQKETPPPPPPEKPKVEE
KSSKVESVKPKASKLSSPSEPQLPPKERERRVAMPRLRKRIANRLKDSQNTFAMLTTFNE
VDMTNLMKLRSDYKDEFVEKHGVKLGLMSCFVKAAVSALQNQPIVNAVIDGDDIIYRDYI
DISVAVGTSKGLVVPVIRDTEGMNFADIEKGINKLAKKATEGALSIDEMAGGTFTISNGG
VYGSLISTPIINPPQSAILGMHSIVQRPVVVDGSILARPMMYLALTYDHRLIDGREAVLF
LRRIKDVVEDPRRMLLDI
Download sequence
Identical sequences I1GQ82
15368.BRADI1G14410.1 XP_003562264.1.954 EG:BRADI1G14410.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]