SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G15260.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G15260.1
Domain Number 1 Region: 299-593
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.12e-52
Family DNA repair protein MutS, domain III 0.00054
Further Details:      
 
Domain Number 2 Region: 598-843
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.3e-50
Family ABC transporter ATPase domain-like 0.00000638
Further Details:      
 
Domain Number 3 Region: 159-310
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.00000602
Family DNA repair protein MutS, domain II 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G15260.1   Gene: BRADI1G15260   Transcript: BRADI1G15260.1
Sequence length 923
Comment pep:novel chromosome:Brachy1.0:1:12195157:12206123:-1 gene:BRADI1G15260 transcript:BRADI1G15260.1
Sequence
MEGEDYLPEGGKLPELKLDARQAQGFISFFKKLPKDPRAIRFFDRRDYYTAHGENATFIA
KTYYHTMTALRQLGSNSDGISSVSVSRAMFETIARNLLLERTDCTLELYEGSGSSWRLAK
SGTPGNIGSFEDILFTNNDMQDSPVTVALFPVLRESQLYIGLSFVDMTNRKLGLAEFPED
SRFTNVESALVALGCKECLLPADFEKPIDLQPLQDAISKCSVLLTERKKADFKSRDLVQD
LGRIIRGSVEPVRDLLSQFDYALGALGALVSYAELLADDTNYGNYTIETYNLDRYMRLDS
AAMRALNIAEGKTDANKNFSLFGLMNRTCTVGMGKRLLNRWLKQPLLDLRQGLRQQLKRI
SDIDRLTHALRKRSANLQPVVKLYQSCRGISYIKDVLQQYNGQFSTLIRKRFVSSFEEWL
TKNRYGRFSEMVETAIDLKQVENGEYRISPGYSSDLAVLKDELSEVENHINNSHMHTATD
LDLSVDKQLKLEKGPFGHVFRISKKEEQKVRKKLTSSYIIIETRKDGVKFTSTKLKKLGE
QYQALLGEYTSCQKKIVDDVVRISCTFSEVFENFAAIISELDVLQSFADLATSCPVPYIR
PDITTSEEGDIVLQGSRHPCLEAQDGVNFIPNDCTLMRGKSWFQIITGPNMGGKSTFIRQ
VGVNVLMAQIGSFVPCDQASISVRDCIFARVGAGDCQLRGVSTFMQEMLETASILKGASE
KSLIIIDELGRGTSTYDGFGLAWAICEHLVEVTRAPTLFATHFHELTALANKNGDQHQHV
PDVGIANYHVGAHIDPSSRKLTMLYKVEPGACDQSFGIHVAEFANFPEAVIALAKSKAEE
LEDFSAAPNFNDESNDEVGSKRKRVFSPDDVTRGAARARVLLEEFSALPLDEMDGRKATE
VVTKLKLDFEKDAAGNPWLQQFL
Download sequence
Identical sequences I1GQH7
EG:BRADI1G15260.1 15368.BRADI1G15260.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]