SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G17060.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G17060.1
Domain Number 1 Region: 3-273
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.63e-90
Family Protein kinases, catalytic subunit 0.00000968
Further Details:      
 
Domain Number 2 Region: 1027-1330
Classification Level Classification E-value
Superfamily ARM repeat 2.65e-35
Family Armadillo repeat 0.0061
Further Details:      
 
Domain Number 3 Region: 505-547,645-668,721-742,825-948,1095-1158
Classification Level Classification E-value
Superfamily ARM repeat 0.000000000704
Family Armadillo repeat 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G17060.1   Gene: BRADI1G17060   Transcript: BRADI1G17060.1
Sequence length 1334
Comment pep:novel chromosome:Brachy1.0:1:13702997:13711893:1 gene:BRADI1G17060 transcript:BRADI1G17060.1
Sequence
MGVDDYHVVELVGEGSFGKVYKGRRKYSRQTVAMKFILKHGKTDKDIHNLRQEIEILRKL
KHENIIEMIDAFETPQEFCVVTEFAQGELFEVLEDDKCLPEEQVQAIAKQLVKALYYLHS
NRIIHRDMKPQNILIGKGSIVKLCDFGFARAMSANTVVLRSIKGTPLYMAPELVREQPYN
HTADLWSLGVILYELFVGQPPFYTNSVYALIRHIVKDPVKYPDNMSANFKSFLKGLLNKL
PQNRLTWPALLEHPFVKDDSVEFLADTQSTPFEVKKSEAPRKADEIQTTKNQPCATEPPS
RNTVNNGENDYDKQKGNKKGGPMPATEGHHGSSPAAISDTPSECTALDKLEKTSQTASGA
SSIIADREALSTVLSPIKIWLSNPSTPPRELNIDGANQSLRIVKNLIEAGSYHSCAAIDD
IICIFLEFTSLIIKTKLSEAYSLVVKCLAIARKLLDTSEALVLSSYGRHWSSLYDLYSQI
LVSTVDPSGRISRESTACLALMLSRVISVLKTSISSEGPNPVEESLANIIDHARKSQLLE
LLCECLIASGSDIISGSTNMVPAACEACKAIWYLAHAVDIVSLGANHFSFPLASSWRKGH
SKSDGKMQEQDSLPDSNSTSLINIFVKSFLASRQMQVAVYHCLHNGLESAIHASLQLISR
ACLLNPSFCAIVCTPLNSSLDVNEVEYGGDGTIVSDMFSLLSLCGSYLNKESKQSNQKCK
LSNPHALVVHCCLALATIAACLKSEGKSSASIILTSSHKKQRSRLSVLAHLSSVDDTVKS
CLQPHCASATLALSTIISLENGGQTRSSLCETALALFPRMATVHTLLKLWLSDGSEELCR
YNAGLLNLFGLRDGSIGLLETRLKWGGPLAIEQACSVGIPQLLVRLLTDGFLRDPSDGKE
GSTHRSGLSPLGVAWTLSALSQCLPGGVFREILYKGEHVKLLTDMLSDMHLKALVAWTGL
GGGKRGVRELINSVVDILAFPFVAVQSSPNMPSTSASINSGFLLNIGSPGGRIGTENKEM
LKTIEHSMPQYIQILLEVGVPGCILRCLDYVNMEDLARPLAIVAKMVGYRPLALQLLREG
LLNPRRVAKLLKGSLAKETLLDFLMIVSDLARMSKDFYEPIDKAGMVEFLKNFLSDEDPD
IRAKACSAIGNMCRHSPYFYSPFAANKVIELVVERCSDPDKRTRKFACFAVGNAAYHNDM
LYEELRGSIPQLTKLLLAPEEDKTKGNAAGALSNLVRNSDILCEDIVSQGAMQALLKMVS
SFSTVALSPSRKDALTESPLRIVLFALRKMCDHTVCRLFLRSSELLPIIVHLRQSPDQTI
SEYASAIASKAYQA
Download sequence
Identical sequences I1GQX9
EG:BRADI1G17060.1 15368.BRADI1G17060.1 XP_003559761.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]