SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G17950.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G17950.1
Domain Number 1 Region: 416-695
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 1.7e-60
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.00097
Further Details:      
 
Domain Number 2 Region: 23-351
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.46e-52
Family Protein kinases, catalytic subunit 0.05
Further Details:      
 
Domain Number 3 Region: 680-835
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 4.03e-43
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G17950.1   Gene: BRADI1G17950   Transcript: BRADI1G17950.1
Sequence length 838
Comment pep:novel chromosome:Brachy1.0:1:14521514:14527780:-1 gene:BRADI1G17950 transcript:BRADI1G17950.1
Sequence
MAAGARRTRELLRPVDAAQALDEAALLRYAAAHVPGFPSPAPSLALSQFGHGQSNPTYCL
EVSVPGGGGETRRYVLRKKPPGAILQSAHAVEREFQVLKALGAYSDVPAPKVFCLCTDAS
VIGTPFYIMEYLEGILYLDTKLPETTPSKRKAIYFAAAKTLAAIHKVDVAAVGLQKYGRR
DNYCKRQVDRWERQYLHSTGEGKPARYPKMLDLVRWLKENVPEEDSSTGLGTGLVHGDYR
VDNLVFHPTEDRVIGVLDWELSTLGNQMCDVAYSCMQYIIDSTPTENSSYGGFERSGIPD
GIPQLEEYLAVYCSMSARPWPVANWKFYIAFSLFRGASIYAGVYHRWTMGNASGGERARF
AGKAGNAMVDCAWNYINRENVLREQPATGMLVSKAPRQEFHREQEGSTSTNGQGRFVPSE
KVMQLREKIMKFMKDHIYPKEDELYKHAQSTSRWTIHPEEENLKALAKEEGLWNLFIPLD
SAARARELLLEDRSHISPGSSDDLLLGAGLTNLEYGYLCEIMGRSVWAPQIFNCGAPDTG
NMEVLLRYGTKEQQKQWLVPLLEGKIRSGFAMTEPQVASSDATNIECAISRQGDFYVING
KKWWTSGAMDPRCKILILMGKTDFSAPKHKQQSMILVDINTPGVQIRRPLLVFGFDDAPH
GHAEITFDNVRVPVNNILLGEGRGFEIAQGRLGPGRLHHCMRLIGAAERGMNMMVERALS
RTAFGKRIAQHGSFQSDLAKCRIELEQARLLVLEAADQLDRHGNKKARGILAMAKVAAPN
MALKVLDMAMQVHGAAGVSSDTVLSHLWATARTLRIADGPDEVHLGTIAKLELQRARL
Download sequence
Identical sequences I1GR74
EG:BRADI1G17950.1 XP_003559808.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]